SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER107W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER107W-A   Protein: S000028755
Sequence length 106
Comment YER107W-A SGDID:S000028755, Chr V from 374390-374710, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, partially overlaps verified ORF GLE2/YER107C"
Sequence
MKSCCGENAISDIESSAGLLMTISLAKSFSFAIAVLVPKAEVVFDRLKKDIVPHFSSSYV
FLYFIVICRLRFMIFDQGGCAGMIGMVSLPNSYKSVSVQVKWLYSA
Download sequence
Identical sequences YER107W-A YER107W-A YER107W-A 4932.YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]