SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YER107W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YER107W-A   Protein: S000028755
Sequence length 106
Comment YER107W-A SGDID:S000028755, Chr V from 374390-374710, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, partially overlaps verified ORF GLE2/YER107C"
Sequence
MKSCCGENAISDIESSAGLLMTISLAKSFSFAIAVLVPKAEVVFDRLKKDIVPHFSSSYV
FLYFIVICRLRFMIFDQGGCAGMIGMVSLPNSYKSVSVQVKWLYSA
Download sequence
Identical sequences W7PIA6
YER107W-A YER107W-A 4932.YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A YER107W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]