SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER114C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER114C
Domain Number 1 Region: 768-886
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-23
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 44-105
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000249
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 3 Region: 259-330
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000102
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell leading edge 1.449 36.33
adherens junction 1.365 31.34
cell cortex 1.627 27.69
focal adhesion 1.752 24.62
chromosomal part 1.477 24.57
nuclear chromosome 1.73 24.57
chromatin 1.822 24.57
apicolateral plasma membrane 2.218 24.17
cell-cell junction 1.378 23.67
filtration diaphragm 2.218 23.67

Protein sequence

External link(s) Locus: YER114C   Protein: S000000916
Sequence length 1040
Comment BOI2 SGDID:S000000916, Chr V from 393708-390586, reverse complement, Verified ORF, "Protein implicated in polar growth, functionally redundant with Boi1p; interacts with bud-emergence protein Bem1p; contains an SH3 (src homology 3) domain and a PH (pleckstrin homology) domain"
Sequence
MSNDREVPTLSQLNTTVSRDKDVSDTLSPDFDSKGSATGRDGGNFPMYIAINEYFKRMED
ELDMKPGDKIKVITDDEEYKDGWYFGRNLRTNEEGLYPVVFTQKITVEKAPTLMRAKSTK
RIYSPLTNEDPLLSSTFISENDSNSELPTPQPIETAASISRTANGKIERNLSLKNTMSDI
DNALLEFKDDSIGPPDRFINSGRDEEHSITHETILSATDGLDVVESNSKPTTSSSTGFLN
GDLENQATLINGIDTTKLNPVEAEFWSPEEITAYFIMEGYDVQSASRFQKHKISGKILLE
LELVHLKELDINSFGTRFEIFKEIEKIKEAIRTNGRSLNRASKTNNANIYNQLMPPANVD
QRASYRGHVRKTSQSLEDLPSQQNFIPTPRNTRNSSASKHRPKSLVFDSQEANANIAPDV
QIPQVVEEMAGNENLFVSPRRAPKPPSYPSPAQPPKSPLLNNTRTSPSPAQLYSWQSPTL
SFSGPKRTSYIDQYSSSDSNFNSRSALPKNNQGGGKALSPIPSPTRNSVRNEDSEGKLTS
SSKRNSVPYYGYAPESSSDRKSSCSSHEEEQFQETMNTFERPTSSIYADGSTIASISNDK
LAHEKEGKKKPTRHSSSLSSKSKSDSRRNSSLKRSSSASRTSSFKKSSFMLSPFRQQFTD
NAARSSSPEENPITSMPSEKNSSPIVDKKSSKKSRSKRRSVSAKEAEIFTETVKDDKNKR
SASEAIKGETLKGKSLRQMTARPVAKKKQTSAFIEGLRSISVKEAMKDADFSGWMSKKGS
GAMSTWKTRFFTLHGTRLSYFSSTTDTRERGLIDITAHRVVPAKEDDKLVSLYAASTGKG
RYCFKLLPPQPGSKKGLTFTQPRTHYFAVDNKEEMRGWMAALIKTTIDIDTSVPIISSYT
TPTVSLSKAQEMLAEAREETKLREQQMLENEEDEDQFLWDQQQLQQQQHDNNQGQADRTI
SASTQRTSDEDNTISTPNLSSANNTTIGSNGFSSPFLLASGLLSPGVARNSSMRGTEKKG
KFSTEEDYFGDNSKHKTDKI
Download sequence
Identical sequences P39969
YER114C 4932.YER114C YER114C YER114C YER114C YER114C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]