SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER114C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER114C
Domain Number 1 Region: 768-886
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-23
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 44-105
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000249
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 3 Region: 259-330
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000102
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
intracellular ribonucleoprotein complex 1.368 53.03
cytoplasmic region 1.567 29.92
actin cytoskeleton 1.374 28.46
ruffle 1.819 27.03
cell-cell junction 1.461 26.75
synapse part 1.419 24.86
cell leading edge 1.426 23.59
cell-substrate junction 1.548 21.31
focal adhesion 1.815 21.31
cytoplasmic vesicle part 1.417 18.46

Protein sequence

External link(s) Locus: YER114C   Protein: S000000916
Sequence length 1040
Comment BOI2 SGDID:S000000916, Chr V from 393708-390586, reverse complement, Verified ORF, "Protein implicated in polar growth, functionally redundant with Boi1p; interacts with bud-emergence protein Bem1p; contains an SH3 (src homology 3) domain and a PH (pleckstrin homology) domain"
Sequence
MSNDREVPTLSQLNTTVSRDKDVSDTLSPDFDSKGSATGRDGGNFPMYIAINEYFKRMED
ELDMKPGDKIKVITDDEEYKDGWYFGRNLRTNEEGLYPVVFTQKITVEKAPTLMRAKSTK
RIYSPLTNEDPLLSSTFISENDSNSELPTPQPIETAASISRTANGKIERNLSLKNTMSDI
DNALLEFKDDSIGPPDRFINSGRDEEHSITHETILSATDGLDVVESNSKPTTSSSTGFLN
GDLENQATLINGIDTTKLNPVEAEFWSPEEITAYFIMEGYDVQSASRFQKHKISGKILLE
LELVHLKELDINSFGTRFEIFKEIEKIKEAIRTNGRSLNRASKTNNANIYNQLMPPANVD
QRASYRGHVRKTSQSLEDLPSQQNFIPTPRNTRNSSASKHRPKSLVFDSQEANANIAPDV
QIPQVVEEMAGNENLFVSPRRAPKPPSYPSPAQPPKSPLLNNTRTSPSPAQLYSWQSPTL
SFSGPKRTSYIDQYSSSDSNFNSRSALPKNNQGGGKALSPIPSPTRNSVRNEDSEGKLTS
SSKRNSVPYYGYAPESSSDRKSSCSSHEEEQFQETMNTFERPTSSIYADGSTIASISNDK
LAHEKEGKKKPTRHSSSLSSKSKSDSRRNSSLKRSSSASRTSSFKKSSFMLSPFRQQFTD
NAARSSSPEENPITSMPSEKNSSPIVDKKSSKKSRSKRRSVSAKEAEIFTETVKDDKNKR
SASEAIKGETLKGKSLRQMTARPVAKKKQTSAFIEGLRSISVKEAMKDADFSGWMSKKGS
GAMSTWKTRFFTLHGTRLSYFSSTTDTRERGLIDITAHRVVPAKEDDKLVSLYAASTGKG
RYCFKLLPPQPGSKKGLTFTQPRTHYFAVDNKEEMRGWMAALIKTTIDIDTSVPIISSYT
TPTVSLSKAQEMLAEAREETKLREQQMLENEEDEDQFLWDQQQLQQQQHDNNQGQADRTI
SASTQRTSDEDNTISTPNLSSANNTTIGSNGFSSPFLLASGLLSPGVARNSSMRGTEKKG
KFSTEEDYFGDNSKHKTDKI
Download sequence
Identical sequences P39969
YER114C 4932.YER114C YER114C YER114C YER114C YER114C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]