SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER114C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER114C
Domain Number 1 Region: 768-886
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-23
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 44-105
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-13
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 3 Region: 259-330
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.02e-11
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Protein sequence

External link(s) Locus: YER114C   Protein: S000000916
Sequence length 1040
Comment BOI2 SGDID:S000000916, Chr V from 393708-390586, reverse complement, Verified ORF, "Protein implicated in polar growth, functionally redundant with Boi1p; interacts with bud-emergence protein Bem1p; contains an SH3 (src homology 3) domain and a PH (pleckstrin homology) domain"
Sequence
MSNDREVPTLSQLNTTVSRDKDVSDTLSPDFDSKGSATGRDGGNFPMYIAINEYFKRMED
ELDMKPGDKIKVITDDEEYKDGWYFGRNLRTNEEGLYPVVFTQKITVEKAPTLMRAKSTK
RIYSPLTNEDPLLSSTFISENDSNSELPTPQPIETAASISRTANGKIERNLSLKNTMSDI
DNALLEFKDDSIGPPDRFINSGRDEEHSITHETILSATDGLDVVESNSKPTTSSSTGFLN
GDLENQATLINGIDTTKLNPVEAEFWSPEEITAYFIMEGYDVQSASRFQKHKISGKILLE
LELVHLKELDINSFGTRFEIFKEIEKIKEAIRTNGRSLNRASKTNNANIYNQLMPPANVD
QRASYRGHVRKTSQSLEDLPSQQNFIPTPRNTRNSSASKHRPKSLVFDSQEANANIAPDV
QIPQVVEEMAGNENLFVSPRRAPKPPSYPSPAQPPKSPLLNNTRTSPSPAQLYSWQSPTL
SFSGPKRTSYIDQYSSSDSNFNSRSALPKNNQGGGKALSPIPSPTRNSVRNEDSEGKLTS
SSKRNSVPYYGYAPESSSDRKSSCSSHEEEQFQETMNTFERPTSSIYADGSTIASISNDK
LAHEKEGKKKPTRHSSSLSSKSKSDSRRNSSLKRSSSASRTSSFKKSSFMLSPFRQQFTD
NAARSSSPEENPITSMPSEKNSSPIVDKKSSKKSRSKRRSVSAKEAEIFTETVKDDKNKR
SASEAIKGETLKGKSLRQMTARPVAKKKQTSAFIEGLRSISVKEAMKDADFSGWMSKKGS
GAMSTWKTRFFTLHGTRLSYFSSTTDTRERGLIDITAHRVVPAKEDDKLVSLYAASTGKG
RYCFKLLPPQPGSKKGLTFTQPRTHYFAVDNKEEMRGWMAALIKTTIDIDTSVPIISSYT
TPTVSLSKAQEMLAEAREETKLREQQMLENEEDEDQFLWDQQQLQQQQHDNNQGQADRTI
SASTQRTSDEDNTISTPNLSSANNTTIGSNGFSSPFLLASGLLSPGVARNSSMRGTEKKG
KFSTEEDYFGDNSKHKTDKI
Download sequence
Identical sequences P39969
YER114C YER114C 4932.YER114C YER114C YER114C YER114C

Jump to [ Top of page · Domain architecture · Domain assignment details ]