SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER123W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER123W
Domain Number 1 Region: 13-332
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.23e-65
Family Protein kinases, catalytic subunit 0.00000000983
Further Details:      
 

Protein sequence

External link(s) Locus: YER123W   Protein: S000000925
Sequence length 524
Comment YCK3 SGDID:S000000925, Chr V from 404809-406383, Verified ORF, "Palmitoylated, vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of the HOPS complex subunit, Vps41p; shares overlapping essential functions with Hrr25p"
Sequence
MSQRSSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIK
FEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGR
KFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNN
DPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLG
HVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSL
KFDEDPDYDYLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNPR
VNGNTARNNVNTNSKTRNTTPVATPKQQAQNSYNKDNSKSRISSNPQSFTKQQHVLKKIE
PNSKYIPETHSNLQRPIKSQSQTYDSISHTQNSPFVPYSSSKANPKRSNNEHNLPNHYTN
LANKNINYQSQRNYEQENDAYSDDENDTFCSKIYKYCCCCFCCC
Download sequence
Identical sequences A6ZR77 B5VHP9 C7GKX0 P39962 W7PIB6
YER123W YER123W 4932.YER123W YER123W YER123W YER123W tr|A6ZR77|A6ZR77_YEAS7 YER123W YER123W YER123W YER123W YER123W

Jump to [ Top of page · Domain architecture · Domain assignment details ]