SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER123W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER123W
Domain Number 1 Region: 13-332
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.23e-65
Family Protein kinases, catalytic subunit 0.00000000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.668 85.69
growth factor binding 1.647 44.44
ATP binding 1.507 39.95
lyase activity 1.42 25
cytokine binding 2.018 23.74
calmodulin binding 2.043 19.32
magnesium ion binding 1.858 16.86
structure-specific DNA binding 2.206 15.3
protein domain specific binding 1.437 12.42
enzyme activator activity 1.476 10.49
Cellular Component IC (bits) H-Score
transferase complex, transferring phosphorus-containing groups 1.653 20.41
centrosome 1.852 15.05
spindle 1.756 12.66
integral component of plasma membrane 1.37 12.19
plasma membrane receptor complex 1.761 12.19
microtubule associated complex 2.062 9.54
chromosomal part 1.471 8.57
cytoplasmic region 1.533 8.36
cell division site 2.089 8.19
midbody 2.148 8

Protein sequence

External link(s) Locus: YER123W   Protein: S000000925
Sequence length 524
Comment YCK3 SGDID:S000000925, Chr V from 404809-406383, Verified ORF, "Palmitoylated, vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of the HOPS complex subunit, Vps41p; shares overlapping essential functions with Hrr25p"
Sequence
MSQRSSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIK
FEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGR
KFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNN
DPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLG
HVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSL
KFDEDPDYDYLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNPR
VNGNTARNNVNTNSKTRNTTPVATPKQQAQNSYNKDNSKSRISSNPQSFTKQQHVLKKIE
PNSKYIPETHSNLQRPIKSQSQTYDSISHTQNSPFVPYSSSKANPKRSNNEHNLPNHYTN
LANKNINYQSQRNYEQENDAYSDDENDTFCSKIYKYCCCCFCCC
Download sequence
Identical sequences A6ZR77 B5VHP9 C7GKX0 P39962 W7PIB6
YER123W YER123W YER123W YER123W YER123W YER123W YER123W 4932.YER123W YER123W tr|A6ZR77|A6ZR77_YEAS7 YER123W YER123W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]