SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER123W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER123W
Domain Number 1 Region: 13-332
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.23e-65
Family Protein kinases, catalytic subunit 9.83e-09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
centrosome 1.805 14.58
spindle pole 2.218 12.59
cytosol 1.305 12.35
axon 1.502 9.91
neuron projection terminus 2.106 9.91
chromosomal part 1.478 9.28
microtubule associated complex 1.998 9.06
nuclear chromosome 1.723 8.53
cell cortex 1.621 8.28
nucleoplasm part 1.419 8.05

Protein sequence

External link(s) Locus: YER123W   Protein: S000000925
Sequence length 524
Comment YCK3 SGDID:S000000925, Chr V from 404809-406383, Verified ORF, "Palmitoylated, vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of the HOPS complex subunit, Vps41p; shares overlapping essential functions with Hrr25p"
Sequence
MSQRSSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIK
FEPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGR
KFSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNN
DPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLG
HVFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSL
KFDEDPDYDYLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNPR
VNGNTARNNVNTNSKTRNTTPVATPKQQAQNSYNKDNSKSRISSNPQSFTKQQHVLKKIE
PNSKYIPETHSNLQRPIKSQSQTYDSISHTQNSPFVPYSSSKANPKRSNNEHNLPNHYTN
LANKNINYQSQRNYEQENDAYSDDENDTFCSKIYKYCCCCFCCC
Download sequence
Identical sequences A6ZR77 B5VHP9 C7GKX0 P39962 W7PIB6
YER123W YER123W 4932.YER123W YER123W YER123W YER123W tr|A6ZR77|A6ZR77_YEAS7 YER123W YER123W YER123W YER123W YER123W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]