SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YER133W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER133W
Domain Number 1 Region: 22-300
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.9e-117
Family Protein serine/threonine phosphatase 0.000000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
endoplasmic reticulum part 1.433 25.06
Molecular Function IC (bits) H-Score
nuclease activity 1.721 70.78
ribonuclease activity 1.943 70.78
phosphoric ester hydrolase activity 1.594 66.72
calmodulin binding 2.026 28.24
drug binding 2.138 26.04
phosphatase binding 2.004 25.74
phosphoric diester hydrolase activity 1.907 12.21
phospholipase activity 2.011 7.39
calcium ion binding 1.342 6.25
phosphoprotein phosphatase activity 2.034 4.74

Protein sequence

External link(s) Locus: YER133W   Protein: S000000935
Sequence length 312
Comment GLC7 SGDID:S000000935, Chr V from 432491-432667,433193-433954, Verified ORF, "Catalytic subunit of type 1 serine/threonine protein phosphatase, involved in many processes including glycogen metabolism, sporulation, and mitosis; interacts with multiple regulatory subunits; predominantly isolated with Sds22p"
Sequence
MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQAGGRKKK
Download sequence
Identical sequences A6ZR87 B3LRP8 C8Z7F0 G2WCZ2 N1P3L5 P32598 W7PUV5
YER133W YER133W YER133W YER133W YER133W SCRT_04610 YER133W YER133W YER133W CX00019 YER133W 4932.YER133W YER133W YER133W YER133W YER133W YER133W YER133W tr|A6ZR87|A6ZR87_YEAS7 YER133W YER133W YER133W YER133W YER133W YER133W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]