SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER133W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER133W
Domain Number 1 Region: 22-300
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.9e-117
Family Protein serine/threonine phosphatase 2.03e-10
Further Details:      
 

Protein sequence

External link(s) Locus: YER133W   Protein: S000000935
Sequence length 312
Comment GLC7 SGDID:S000000935, Chr V from 432491-432667,433193-433954, Verified ORF, "Catalytic subunit of type 1 serine/threonine protein phosphatase, involved in many processes including glycogen metabolism, sporulation, and mitosis; interacts with multiple regulatory subunits; predominantly isolated with Sds22p"
Sequence
MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQAGGRKKK
Download sequence
Identical sequences A6ZR87 B3LRP8 C8Z7F0 G2WCZ2 P32598
YER133W YER133W YER133W YER133W YER133W YER133W YER133W YER133W YER133W CX00019 YER133W YER133W YER133W 4932.YER133W YER133W SCRT_04610 YER133W YER133W tr|A6ZR87|A6ZR87_YEAS7 YER133W YER133W YER133W YER133W YER133W YER133W

Jump to [ Top of page · Domain architecture · Domain assignment details ]