SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER133W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER133W
Domain Number 1 Region: 22-300
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.9e-117
Family Protein serine/threonine phosphatase 0.000000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
nuclease activity 1.69 70.67
ribonuclease activity 1.939 70.67
phosphoric ester hydrolase activity 1.596 67.74
calmodulin binding 2.02 28.15
phospholipid binding 1.517 27.98
drug binding 2.131 25.83
phosphatase binding 1.998 25.61
phosphoric diester hydrolase activity 1.903 12.21
iron ion binding 2.227 7.41
phospholipase activity 2.013 7.38
Cellular Component IC (bits) H-Score
endoplasmic reticulum part 1.431 25.02

Protein sequence

External link(s) Locus: YER133W   Protein: S000000935
Sequence length 312
Comment GLC7 SGDID:S000000935, Chr V from 432491-432667,433193-433954, Verified ORF, "Catalytic subunit of type 1 serine/threonine protein phosphatase, involved in many processes including glycogen metabolism, sporulation, and mitosis; interacts with multiple regulatory subunits; predominantly isolated with Sds22p"
Sequence
MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQAGGRKKK
Download sequence
Identical sequences A6ZR87 B3LRP8 C8Z7F0 G2WCZ2 N1P3L5 P32598 W7PUV5
YER133W YER133W YER133W SCRT_04610 CX00019 YER133W YER133W tr|A6ZR87|A6ZR87_YEAS7 YER133W YER133W YER133W YER133W YER133W YER133W YER133W 4932.YER133W YER133W YER133W YER133W YER133W YER133W YER133W YER133W YER133W YER133W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]