SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER133W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YER133W-A
Domain Number - Region: 6-82
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0745
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.022
Further Details:      
 

Protein sequence

External link(s) Locus: YER133W-A   Protein: S000028756
Sequence length 113
Comment YER133W-A SGDID:S000028756, Chr V from 437187-437528, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps uncharacterized gene YER134C."
Sequence
MYHLPINVMTSSYAQMMLCELSAQSFKPFHSGNLDKVSKMVHSLGLLHKQTSLRISPLLC
FYFHHQINKSFSILNRWYYKDLSNRPLNGQFYFFLPTEIHRTGWPTGLRHQHT
Download sequence
Identical sequences W7PW31
YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A 4932.YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]