SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER133W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YER133W-A
Domain Number - Region: 6-82
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0745
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YER133W-A   Protein: S000028756
Sequence length 113
Comment YER133W-A SGDID:S000028756, Chr V from 437187-437528, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps uncharacterized gene YER134C."
Sequence
MYHLPINVMTSSYAQMMLCELSAQSFKPFHSGNLDKVSKMVHSLGLLHKQTSLRISPLLC
FYFHHQINKSFSILNRWYYKDLSNRPLNGQFYFFLPTEIHRTGWPTGLRHQHT
Download sequence
Identical sequences W7PW31
YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A YER133W-A 4932.YER133W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]