SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER145C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YER145C   Protein: S000000947
Sequence length 404
Comment FTR1 SGDID:S000000947, Chr V from 461735-460521, reverse complement, Verified ORF, "High affinity iron permease involved in the transport of iron across the plasma membrane; forms complex with Fet3p; expression is regulated by iron"
Sequence
MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQVWVGVLLGFI
ICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMISMMGIPMLRMNKMQSKWRVK
IARSLVEIPHRKRDYFKIGFLSRRYAMFLLPFITVLREGLEAVVFVAGAGITTQGSHASA
YPLPVVVGLICGGLVGYLLYYGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFN
LASGGDASEGGDGNGSYNIRKAVYHVNCCNPELDNGWDIFNALLGWQNTGYLSSMLCYNI
YWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTEEQKRQLFAKMEN
INFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLHVKADSL
Download sequence
Identical sequences B3LRQ8 C7GQ51 E7KBX9 N1PA60 P40088 W7PID0 W7R3M9
YER145C YER145C SCRT_04620 2234S YER145C YER145C YER145C YER145C YER145C YER145C YER145C 4932.YER145C YER145C YER145C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]