SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER145C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER145C   Protein: S000000947
Sequence length 404
Comment FTR1 SGDID:S000000947, Chr V from 461735-460521, reverse complement, Verified ORF, "High affinity iron permease involved in the transport of iron across the plasma membrane; forms complex with Fet3p; expression is regulated by iron"
Sequence
MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQVWVGVLLGFI
ICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMISMMGIPMLRMNKMQSKWRVK
IARSLVEIPHRKRDYFKIGFLSRRYAMFLLPFITVLREGLEAVVFVAGAGITTQGSHASA
YPLPVVVGLICGGLVGYLLYYGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFN
LASGGDASEGGDGNGSYNIRKAVYHVNCCNPELDNGWDIFNALLGWQNTGYLSSMLCYNI
YWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTEEQKRQLFAKMEN
INFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLHVKADSL
Download sequence
Identical sequences B3LRQ8 C7GQ51 E7KBX9 N1PA60 P40088 W7PID0 W7R3M9
YER145C 4932.YER145C YER145C YER145C SCRT_04620 YER145C YER145C YER145C YER145C YER145C YER145C 2234S YER145C YER145C

Jump to [ Top of page · Domain architecture · Domain assignment details ]