SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YER145C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YER145C-A   Protein: S000028758
Sequence length 145
Comment YER145C-A SGDID:S000028758, Chr V from 462818-462381, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified ORF LSM5/YER146W"
Sequence
MAILLPLKSILPWCCITFSFLLSSSGSISHSTASSSITLTKSSKPTNVPSNSRFDCSTIN
TFWLIVLSMTSKGKISGRLILRASVYACECTCIRYACCETIYPPRKPFSLSLYFFYFNKK
ASILFCYPDAKTKPEHPGNKRAGSG
Download sequence
Identical sequences YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A 4932.YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]