SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER145C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER145C-A   Protein: S000028758
Sequence length 145
Comment YER145C-A SGDID:S000028758, Chr V from 462818-462381, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified ORF LSM5/YER146W"
Sequence
MAILLPLKSILPWCCITFSFLLSSSGSISHSTASSSITLTKSSKPTNVPSNSRFDCSTIN
TFWLIVLSMTSKGKISGRLILRASVYACECTCIRYACCETIYPPRKPFSLSLYFFYFNKK
ASILFCYPDAKTKPEHPGNKRAGSG
Download sequence
Identical sequences YER145C-A YER145C-A 4932.YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A YER145C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]