SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER147C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YER147C-A   Protein: S000028759
Sequence length 136
Comment YER147C-A SGDID:S000028759, Chr V from 465608-465198, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MMTAAKRLGLYSALRACSATVFRSNLHPKVTVATMFCSVGTIPDVAEVSFSDSGAALFMS
SSLWKVVAGFVPSRFWFSHTCLVFGSNTILFASLNSFKRSSSAIIKKVSLDTPVYVGLEK
KNKMQPLLPCFFRRAV
Download sequence
Identical sequences B5VHS5 C8Z7G9 W7PM54
YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A 4932.YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]