SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER147C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER147C-A   Protein: S000028759
Sequence length 136
Comment YER147C-A SGDID:S000028759, Chr V from 465608-465198, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MMTAAKRLGLYSALRACSATVFRSNLHPKVTVATMFCSVGTIPDVAEVSFSDSGAALFMS
SSLWKVVAGFVPSRFWFSHTCLVFGSNTILFASLNSFKRSSSAIIKKVSLDTPVYVGLEK
KNKMQPLLPCFFRRAV
Download sequence
Identical sequences B5VHS5 C8Z7G9
YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A 4932.YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A YER147C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]