SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER148W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER148W-A   Protein: S000028760
Sequence length 192
Comment YER148W-A SGDID:S000028760, Chr V from 466180-466758, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MFYNKMFIHSISGGSSLLSASEVFASAFFSKASSLSSLNLCSRSSDNSFSYFLCVLVSTF
LNSLVIIESERDPEPLVGLPTEEGELGSQVTGELAGDDMPKLCLLEFSLLLAFSSSLFSC
SNSCNFFSVLLKFEWLFNNLSCNSLLVRVSFSISCTYSARSFSNCLVKKLCASCKSLNAV
SSSSNFLEESSS
Download sequence
Identical sequences C8Z7H1
YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A 4932.YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]