SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER148W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YER148W-A   Protein: S000028760
Sequence length 192
Comment YER148W-A SGDID:S000028760, Chr V from 466180-466758, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MFYNKMFIHSISGGSSLLSASEVFASAFFSKASSLSSLNLCSRSSDNSFSYFLCVLVSTF
LNSLVIIESERDPEPLVGLPTEEGELGSQVTGELAGDDMPKLCLLEFSLLLAFSSSLFSC
SNSCNFFSVLLKFEWLFNNLSCNSLLVRVSFSISCTYSARSFSNCLVKKLCASCKSLNAV
SSSSNFLEESSS
Download sequence
Identical sequences C8Z7H1 W7PW47
YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A 4932.YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A YER148W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]