SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER151C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER151C
Domain Number 1 Region: 458-527,559-601,695-911
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.77e-66
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
sarcolemma 1.922 11.89
endosome 1.323 9.1
secretory granule 1.818 7.75
endocytic vesicle 1.433 7.61
vacuolar part 1.621 7.2
extracellular organelle 1.606 5.57
transferase complex 1.423 5.37
nucleoplasm part 1.496 5.37
lytic vacuole 1.571 5
cytosol 1.301 4.91

Protein sequence

External link(s) Locus: YER151C   Protein: S000000953
Sequence length 912
Comment UBP3 SGDID:S000000953, Chr V from 472419-469681, reverse complement, Verified ORF, "Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin"
Sequence
MNMQDANKEESYSMYPKTSSPPPPTPTNMQIPIYQAPLQMYGYTQAPYLYPTQIPAYSFN
MVNQNQPIYHQSGSPHHLPPQNNINGGSTTNNNNINKKKWHSNGITNNNGSSGNQGANSS
GSGMSYNKSHTYHHNYSNNHIPMMASPNSGSNAGMKKQTNSSNGNGSSATSPSYSSYNSS
SQYDLYKFDVTKLKNLKENSSNLIQLPLFINTTEAEFAAASVQRYELNMKALNLNSESLE
NSSVEKSSAHHHTKSHSIPKHNEEVKTETHGEEEDAHDKKPHASKDAHELKKKTEVKKED
AKQDRNEKVIQEPQATVLPVVDKKEPEESVEENTSKTSSPSPSPPAAKSWSAIASDAIKS
RQASNKTVSGSMVTKTPISGTTAGVSSTNMAAATIGKSSSPLLSKQPQKKDKKYVPPSTK
GIEPLGSIALRMCFDPDFISYVLRNKDVENKIPVHSIIPRGIINRANICFMSSVLQVLLY
CKPFIDVINVLSTRNTNSRVGTSSCKLLDACLTMYKQFDKETYEKKFLENADDAEKTTES
DAKKSSKSKSFQHCATADAVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQLHEE
LISAIDGLTDNEIQNMLQSINDEQLKVFFIRNLSRYGKAEFIKNASPRLKELIEKYGVIN
DDSTEENGWHEVSGSSKRGKKTKTAAKRTVEIVPSPISKLFGGQFRSVLDIPNNKESQSI
TLDPFQTIQLDISDAGVNDLETAFKKFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLI
QFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLKNNTSGID
DRRYKLTGVIYHHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGEEASDS
RTAYILMYQKRN
Download sequence
Identical sequences Q01477
YER151C 4932.YER151C YER151C YER151C YER151C YER151C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]