SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER151C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER151C
Domain Number 1 Region: 458-527,559-601,695-911
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.77e-66
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00054
Further Details:      
 

Protein sequence

External link(s) Locus: YER151C   Protein: S000000953
Sequence length 912
Comment UBP3 SGDID:S000000953, Chr V from 472419-469681, reverse complement, Verified ORF, "Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin"
Sequence
MNMQDANKEESYSMYPKTSSPPPPTPTNMQIPIYQAPLQMYGYTQAPYLYPTQIPAYSFN
MVNQNQPIYHQSGSPHHLPPQNNINGGSTTNNNNINKKKWHSNGITNNNGSSGNQGANSS
GSGMSYNKSHTYHHNYSNNHIPMMASPNSGSNAGMKKQTNSSNGNGSSATSPSYSSYNSS
SQYDLYKFDVTKLKNLKENSSNLIQLPLFINTTEAEFAAASVQRYELNMKALNLNSESLE
NSSVEKSSAHHHTKSHSIPKHNEEVKTETHGEEEDAHDKKPHASKDAHELKKKTEVKKED
AKQDRNEKVIQEPQATVLPVVDKKEPEESVEENTSKTSSPSPSPPAAKSWSAIASDAIKS
RQASNKTVSGSMVTKTPISGTTAGVSSTNMAAATIGKSSSPLLSKQPQKKDKKYVPPSTK
GIEPLGSIALRMCFDPDFISYVLRNKDVENKIPVHSIIPRGIINRANICFMSSVLQVLLY
CKPFIDVINVLSTRNTNSRVGTSSCKLLDACLTMYKQFDKETYEKKFLENADDAEKTTES
DAKKSSKSKSFQHCATADAVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQLHEE
LISAIDGLTDNEIQNMLQSINDEQLKVFFIRNLSRYGKAEFIKNASPRLKELIEKYGVIN
DDSTEENGWHEVSGSSKRGKKTKTAAKRTVEIVPSPISKLFGGQFRSVLDIPNNKESQSI
TLDPFQTIQLDISDAGVNDLETAFKKFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLI
QFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLKNNTSGID
DRRYKLTGVIYHHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGEEASDS
RTAYILMYQKRN
Download sequence
Identical sequences Q01477
YER151C YER151C 4932.YER151C YER151C YER151C YER151C

Jump to [ Top of page · Domain architecture · Domain assignment details ]