SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER155C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER155C
Domain Number 1 Region: 1961-2165
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 1061-1095,1141-1312,1422-1531,1572-1670
Classification Level Classification E-value
Superfamily Ras GEF 4.97e-20
Family Ras GEF 0.009
Further Details:      
 
Domain Number 3 Region: 401-885
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-19
Family Ras GEF 0.015
Further Details:      
 
Domain Number 4 Region: 1890-1944
Classification Level Classification E-value
Superfamily PH domain-like 0.00000939
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell leading edge 1.401 35.37
ruffle 1.765 34.07
cytoplasmic region 1.533 26.89
cell-substrate junction 1.489 20.49
microtubule cytoskeleton 1.346 19.34
spindle 1.756 19.34
actin cytoskeleton 1.39 19.3
cell-cell junction 1.43 19.18
postsynapse 1.608 17.7
plasma membrane protein complex 1.498 15.41

Protein sequence

External link(s) Locus: YER155C   Protein: S000000957
Sequence length 2167
Comment BEM2 SGDID:S000000957, Chr V from 482843-476340, reverse complement, Verified ORF, "Rho GTPase activating protein (RhoGAP) involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence"
Sequence
MKGLLWSKNRKSSTASASSSSTSTSHKTTTASTASSSSPSSSSQTIRNSTSGASPYMHSH
HHHGQGHSHHRGEDNNRDKRKSSVFPPSKQYTSTSSSQVNLGMYHSDTNTRSSRSIASTL
KDDSPSVCSEDEISNSSSQKSNAQDETPIAYKKSAHSKDSLLPSRSSSLSPPQSRCSTGT
TLEKSLNTSGISNSSGTNNNNSNNNNDNEQKQRNVIHLNSENYDTTVFKTGWVNKSHGQT
VATNYNSSMTAPSSSSSSSSQNLRNDAYSRNRESRFYGNDGSSLKNDDSSSTTATNSGND
VASARSSMAIDPQMLVPDYRLYRAQLKGCVLNLYKSGLNSNIKFFDPTLPASNSSIANEN
HQQKKQQTNNQAQAEALHQKQSFGQMGEPITLDLKYLSEVYPHPDLRQDSDGKIISGTIE
SLCHTVLFYPGPKQSDVPNEKSLSKTHRAVINLLLMFPLLDHFIKFLKVFNQFGLSFTKN
KSRLTNNSTQFYNISPAVDDSMTQRLALTAKTILDVFPGFLLDEPMLKTIISLLDTISLH
NDEISNNLKIKIANKHNELMKLTAFTRSLPMATSSTHELEIILDPSHFLSLDITTLADEV
HHINLKFDKVWAPKFDYSLLYDSKFINRRIVSLNPLVFNNDQNIHFLGRLLISHLFPTNP
EFSKKVTPKVRAELLDKWVQIGCRFEHLGDMVSWLAVATIICSIPVLRSSSWKYVPDQSL
KTIFKDWVPTIIQLERRQRTSKSTSSVFILAPPNLDDDFTRANVISYFGDLLIHADDLPS
DTKFKYLEKKINRTKNAFHKWQQRLQAIDSTRHKTNSTENVRDNDSPNNVVYQLWKFHLS
QPPLNIEGIMKLSVQHEPPIIDQKAYSTIGSQRSALVTGSYLPILFNELFPNYSLFPKNT
LVGAASDAKLPPPRSSARLSKSLSISEPIPIASNSHTMGSLTDDAMSSKNDNNKVTGVGK
IDGPVIKEMSSKQSNKQRLLKSVRDVFNIDMDVFHISDELVFKSVYDNDGKSRPASMVIE
TPKRFSQHSSMLINNPATPNQKMRDSLDTTGRLSKTLENMDFFNNIGQVSDSLKESIIRV
VLKSSSLEKIFDLLVLTSNIFSKLVDTKDLENYYYHQRQRGHSTRGLSDDNIGLLDYAFV
KLTMDNDIFTETFFNTYKSFTTTTTVLENMAKRYVGAKSCSVSISKILDRSDDSKMKINE
DTNLVSSSLYDQNFPVWDMKVTDDENINLIYMAKIQIGAAEAILHLVKNHYSDFTDDLCN
NSTLLDIIKIMEQEVSTEWPTRIANSKLQKSLPENFVIETENLLTTLTDLFHGIKSAYQK
QLYRPIGVNRTQKRITDILNSFNTFSFTDLNNIIDDPSFSDDMIRSFQKLHSTNYEDILE
WIYQLDNFISKKFNLVSKKDWIVLFQELELLSKESLVSFFNYPLHFKSSKLINPGYLQLH
EFEISNLFTWISTLILKDDNGTESLFFEKLPQSIKLLIKLHTSLTTFFVMEISNVNKSSS
ERLTTCKVILQILNYIRWKNGSLDLFDSEEDESPHAICPHIPAFIETAIAHAIISPESRN
YELSWIKASEKLSDPTKGTQNLRSISNVLEKIDDIHIKRFIEIDDVFSKNCKNLCPCPGW
FISRLLEISQFVPNMSITNSKLINFDKRRFVNNIISNVLDLIPNEREFPLDIEMSDENPS
KRTTFGRILFNNFEDVNKVYRKKTKKVSESEAISERFQEQGVFNEILVNEIEKIKREARK
LEVLLDQEKILKNSAALHQAVPKKNRKSVIISGTHSDNDHSYNINKNTGQTPSLGSVMES
NNSARNRRDSRASFSTNRSSVVSNSSHNGVSKKIGGFFRRPFSIGGFNTSSSNYSLNSIL
SQEVSSNKSILPSILPEVDSMQLHDLKPSYSLKTFEIKSIMEIINHRNIPAYYYAFKIVM
QNGHEYLIQTASSSDLTEWIKMIKASKRFSFHSKKYKGKTHNKIFGVPLEDVCERENTLI
PTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNA
IAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQT
LKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQEDLANSMGSRLGAVQTILQDFIKN
PNDYFKQ
Download sequence
Identical sequences N1P5E3 P39960
4932.YER155C YER155C YER155C YER155C YER155C YER155C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]