SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER155C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER155C
Domain Number 1 Region: 1961-2165
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 1061-1095,1141-1312,1422-1531,1572-1670
Classification Level Classification E-value
Superfamily Ras GEF 4.97e-20
Family Ras GEF 0.009
Further Details:      
 
Domain Number 3 Region: 401-885
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-19
Family Ras GEF 0.015
Further Details:      
 
Domain Number 4 Region: 1890-1944
Classification Level Classification E-value
Superfamily PH domain-like 9.39e-06
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell leading edge 1.447 45.9
ruffle 1.805 38.78
cell cortex 1.621 28.71
adherens junction 1.365 27.35
focal adhesion 1.751 24.65
lytic vacuole 1.57 23.81
synapse part 1.512 12.93
endosome membrane 1.967 11.78
cell division site 2.218 10.27
perinuclear region of cytoplasm 1.467 10.25

Protein sequence

External link(s) Locus: YER155C   Protein: S000000957
Sequence length 2167
Comment BEM2 SGDID:S000000957, Chr V from 482843-476340, reverse complement, Verified ORF, "Rho GTPase activating protein (RhoGAP) involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence"
Sequence
MKGLLWSKNRKSSTASASSSSTSTSHKTTTASTASSSSPSSSSQTIRNSTSGASPYMHSH
HHHGQGHSHHRGEDNNRDKRKSSVFPPSKQYTSTSSSQVNLGMYHSDTNTRSSRSIASTL
KDDSPSVCSEDEISNSSSQKSNAQDETPIAYKKSAHSKDSLLPSRSSSLSPPQSRCSTGT
TLEKSLNTSGISNSSGTNNNNSNNNNDNEQKQRNVIHLNSENYDTTVFKTGWVNKSHGQT
VATNYNSSMTAPSSSSSSSSQNLRNDAYSRNRESRFYGNDGSSLKNDDSSSTTATNSGND
VASARSSMAIDPQMLVPDYRLYRAQLKGCVLNLYKSGLNSNIKFFDPTLPASNSSIANEN
HQQKKQQTNNQAQAEALHQKQSFGQMGEPITLDLKYLSEVYPHPDLRQDSDGKIISGTIE
SLCHTVLFYPGPKQSDVPNEKSLSKTHRAVINLLLMFPLLDHFIKFLKVFNQFGLSFTKN
KSRLTNNSTQFYNISPAVDDSMTQRLALTAKTILDVFPGFLLDEPMLKTIISLLDTISLH
NDEISNNLKIKIANKHNELMKLTAFTRSLPMATSSTHELEIILDPSHFLSLDITTLADEV
HHINLKFDKVWAPKFDYSLLYDSKFINRRIVSLNPLVFNNDQNIHFLGRLLISHLFPTNP
EFSKKVTPKVRAELLDKWVQIGCRFEHLGDMVSWLAVATIICSIPVLRSSSWKYVPDQSL
KTIFKDWVPTIIQLERRQRTSKSTSSVFILAPPNLDDDFTRANVISYFGDLLIHADDLPS
DTKFKYLEKKINRTKNAFHKWQQRLQAIDSTRHKTNSTENVRDNDSPNNVVYQLWKFHLS
QPPLNIEGIMKLSVQHEPPIIDQKAYSTIGSQRSALVTGSYLPILFNELFPNYSLFPKNT
LVGAASDAKLPPPRSSARLSKSLSISEPIPIASNSHTMGSLTDDAMSSKNDNNKVTGVGK
IDGPVIKEMSSKQSNKQRLLKSVRDVFNIDMDVFHISDELVFKSVYDNDGKSRPASMVIE
TPKRFSQHSSMLINNPATPNQKMRDSLDTTGRLSKTLENMDFFNNIGQVSDSLKESIIRV
VLKSSSLEKIFDLLVLTSNIFSKLVDTKDLENYYYHQRQRGHSTRGLSDDNIGLLDYAFV
KLTMDNDIFTETFFNTYKSFTTTTTVLENMAKRYVGAKSCSVSISKILDRSDDSKMKINE
DTNLVSSSLYDQNFPVWDMKVTDDENINLIYMAKIQIGAAEAILHLVKNHYSDFTDDLCN
NSTLLDIIKIMEQEVSTEWPTRIANSKLQKSLPENFVIETENLLTTLTDLFHGIKSAYQK
QLYRPIGVNRTQKRITDILNSFNTFSFTDLNNIIDDPSFSDDMIRSFQKLHSTNYEDILE
WIYQLDNFISKKFNLVSKKDWIVLFQELELLSKESLVSFFNYPLHFKSSKLINPGYLQLH
EFEISNLFTWISTLILKDDNGTESLFFEKLPQSIKLLIKLHTSLTTFFVMEISNVNKSSS
ERLTTCKVILQILNYIRWKNGSLDLFDSEEDESPHAICPHIPAFIETAIAHAIISPESRN
YELSWIKASEKLSDPTKGTQNLRSISNVLEKIDDIHIKRFIEIDDVFSKNCKNLCPCPGW
FISRLLEISQFVPNMSITNSKLINFDKRRFVNNIISNVLDLIPNEREFPLDIEMSDENPS
KRTTFGRILFNNFEDVNKVYRKKTKKVSESEAISERFQEQGVFNEILVNEIEKIKREARK
LEVLLDQEKILKNSAALHQAVPKKNRKSVIISGTHSDNDHSYNINKNTGQTPSLGSVMES
NNSARNRRDSRASFSTNRSSVVSNSSHNGVSKKIGGFFRRPFSIGGFNTSSSNYSLNSIL
SQEVSSNKSILPSILPEVDSMQLHDLKPSYSLKTFEIKSIMEIINHRNIPAYYYAFKIVM
QNGHEYLIQTASSSDLTEWIKMIKASKRFSFHSKKYKGKTHNKIFGVPLEDVCERENTLI
PTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNA
IAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQT
LKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQEDLANSMGSRLGAVQTILQDFIKN
PNDYFKQ
Download sequence
Identical sequences N1P5E3 P39960
YER155C YER155C 4932.YER155C YER155C YER155C YER155C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]