SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER165C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER165C-A   Protein: S000028762
Sequence length 118
Comment YER165C-A SGDID:S000028762, Chr V from 512978-512622, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene DNF1/YER166W"
Sequence
MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWPAVFVACCTIIKMGRCNMCIFITAIIFKL
KCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPGGNKGFLLRLLSLAQPPVNF
Download sequence
Identical sequences C8Z7I8 W7PUZ0
YER165C-A YER165C-A 4932.YER165C-A YER165C-A YER165C-A YER165C-A YER165C-A YER165C-A YER165C-A YER165C-A YER165C-A YER165C-A YER165C-A YER165C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]