SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER166W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER166W
Domain Number 1 Region: 189-278,536-659,1177-1405
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.53e-52
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 
Domain Number 2 Region: 660-676,965-1174
Classification Level Classification E-value
Superfamily HAD-like 1.97e-32
Family Meta-cation ATPase, catalytic domain P 0.036
Further Details:      
 
Domain Number 3 Region: 671-687,765-971
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.1e-20
Family Metal cation-transporting ATPase, ATP-binding domain N 0.01
Further Details:      
 
Domain Number 4 Region: 390-453,494-532
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.55e-17
Family Calcium ATPase, transduction domain A 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YER166W   Protein: S000000968
Sequence length 1571
Comment DNF1 SGDID:S000000968, Chr V from 512739-517454, Verified ORF, "Aminophospholipid translocase (flippase) that localizes primarily to the plasma membrane; contributes to endocytosis, protein transport and cell polarity; type 4 P-type ATPase"
Sequence
MSGTFHGDGHAPMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPK
NKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPHTNYDGMKRFRMG
TKRNKKGNPIMGRSKTLKWARKNIPNPFEDFTKDDIDPGAINRAQELRTVYYNMPLPKDM
IDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNP
GLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFK
KANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSAD
YGRPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADII
LLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYT
YQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPT
KKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFV
SFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQ
VEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIA
KDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSV
LVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNIL
EFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHL
EQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGG
TAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGD
DVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLA
LYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQS
ADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFAL
ALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGI
LRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAV
ISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWA
VFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKA
GQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSPKET
QDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNRYSVERARTSLDLPGVTN
AASLIGTQQNN
Download sequence
Identical sequences N1P787 P32660
YER166W YER166W 4932.YER166W YER166W YER166W YER166W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]