SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YER168C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER168C
Domain Number 1 Region: 203-319,390-542
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 5.36e-46
Family Poly A polymerase C-terminal region-like 0.0013
Further Details:      
 
Domain Number 2 Region: 44-201
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.49e-30
Family Poly A polymerase head domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.334 28.44
nucleolus 1.723 7.5
mitochondrial matrix 1.568 5.88
Molecular Function IC (bits) H-Score
adenylyltransferase activity 2.069 135.97
nucleotidyltransferase activity 1.506 101.64
DNA polymerase activity 2.118 24.6
phosphoric ester hydrolase activity 1.483 22.43
lyase activity 1.395 16.53
ATP binding 1.435 8.18
manganese ion binding 2.129 4.22
mRNA binding 2.118 3.63

Protein sequence

External link(s) Locus: YER168C   Protein: S000000970
Sequence length 546
Comment CCA1 SGDID:S000000970, Chr V from 522664-521024, reverse complement, Verified ORF, "ATP (CTP):tRNA-specific tRNA nucleotidyltransferase; different forms targeted to the nucleus, cytosol, and mitochondrion are generated via the use of multiple transcriptional and translational start sites"
Sequence
MLRSTISLLMNSAAQKTMTNSNFVLNAPKITLTKVEQNICNLLNDYTDLYNQKYHNKPEP
LTLRITGGWVRDKLLGQGSHDLDIAINVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKID
KNPEKSKHLETATTKLFGVEVDFVNLRSEKYTELSRIPKVCFGTPEEDALRRDATLNALF
YNIHKGEVEDFTKRGLQDLKDGVLRTPLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVM
AEMGDPQINVAFNSKISRERVGVEMEKILVGPTPLLALQLIQRAHLENVIFFWHNDSSVV
KFNEENCQDMDKINHVYNDNILNSHLKSFIELYPMFLEKLPILREKIGRSPGFQQNFILS
AILSPMANLQIIGNPKKKINNLVSVTESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAK
FADRSQLKKSEIGIFLRNFNGEWETAHFASLSDAFLKIPKLETKKIELLFQNYNEFYSYI
FDNNLNNCHELKPIVDGKQMAKLLQMKPGPWLGKINNEAIRWQFDNPTGTDQELITHLKA
ILPKYL
Download sequence
Identical sequences A6ZRC4 B3LRS8 B5VHU6 C7GS42 G2WD54 P21269 W7Q538 W7RG56
YER168C YER168C 355313 YER168C SCRT_04642 4932.YER168C tr|A6ZRC4|A6ZRC4_YEAS7 YER168C YER168C YER168C YER168C YER168C YER168C YER168C YER168C YER168C YER168C YER168C YER168C YER168C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]