SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YER172C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YER172C-A   Protein: S000028763
Sequence length 126
Comment YER172C-A SGDID:S000028763, Chr V from 536650-536270, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MTVLLEHPLGPDSSRILCLALGKNMASKASCTSLSFLLCMATCSKQLGLNFSYHCSPPSS
LILGRILDVSCLERKSFSVLLALRTGEVGLDELHFVICEPNELRLYCNKGRLFKFVLSIS
FRQEQT
Download sequence
Identical sequences C8Z7J5 W7PIF2
YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A 4932.YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]