SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YER172C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YER172C-A   Protein: S000028763
Sequence length 126
Comment YER172C-A SGDID:S000028763, Chr V from 536650-536270, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MTVLLEHPLGPDSSRILCLALGKNMASKASCTSLSFLLCMATCSKQLGLNFSYHCSPPSS
LILGRILDVSCLERKSFSVLLALRTGEVGLDELHFVICEPNELRLYCNKGRLFKFVLSIS
FRQEQT
Download sequence
Identical sequences C8Z7J5 W7PIF2
YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A 4932.YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A YER172C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]