SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFL002C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL002C
Domain Number 1 Region: 86-386
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.44e-57
Family Tandem AAA-ATPase domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.332 27.17
transporter complex 1.655 21.75
cilium 1.616 21.53
chromosomal part 1.456 20.39
ciliary part 1.785 20.28
midbody 2.192 17.88
side of membrane 1.587 15.98
protein-DNA complex 1.891 15.71
endosome 1.317 12.57
plasma membrane protein complex 1.484 10.85

Protein sequence

External link(s) Locus: YFL002C   Protein: S000001894
Sequence length 606
Comment SPB4 SGDID:S000001894, Chr VI from 146929-145109, reverse complement, Verified ORF, "Putative ATP-dependent RNA helicase, nucleolar protein required for synthesis of 60S ribosomal subunits at a late step in the pathway; sediments with 66S pre-ribosomes in sucrose gradients"
Sequence
MSKSLEWDNLGFSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAA
FVIPVLEKVVKEEANTSKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQ
LLVGTNEATVRDDVSNFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDM
SFIKDTEKILRLLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNY
CVVNPAEKLQLLVSILNNYKFKKCIVYFPTCVSVSYFYSFIQYLGKRNILVNEVEIFSLH
GKLQTSARTKTLTAFTDSLSNSVLFTTDVAARGIDIPDVDLVIQLDPPTNTDMFMHRCGR
TGRANRVGKAITFLNEGREEDFIPFMQVKNVELEELDLEVKGITTNFYEDFRNWILEDRD
RFDKGVKAYVAFIKYYSNHSATSIFRLQSLDYVGIAKLYGLFRLPRMPEITKYLATEKQE
GIFPGNWLVDPPVNMDEYKYKDKKREKERQETLKNISLINDKKKLKSELKKKNLAWSDKT
LTKERKLERKEKMSLKRKAIEEELKAEELDENAEEERIKEDWKEIVLQNKRKKVSSKAIQ
GNFDDL
Download sequence
Identical sequences A7A237 P25808
YFL002C sp|A7A237|SPB4_YEAS7 YFL002C YFL002C YFL002C 4932.YFL002C YFL002C YFL002C YFL002C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]