SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFL002C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL002C
Domain Number 1 Region: 86-386
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.44e-57
Family Tandem AAA-ATPase domain 0.00039
Further Details:      
 

Protein sequence

External link(s) Locus: YFL002C   Protein: S000001894
Sequence length 606
Comment SPB4 SGDID:S000001894, Chr VI from 146929-145109, reverse complement, Verified ORF, "Putative ATP-dependent RNA helicase, nucleolar protein required for synthesis of 60S ribosomal subunits at a late step in the pathway; sediments with 66S pre-ribosomes in sucrose gradients"
Sequence
MSKSLEWDNLGFSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAA
FVIPVLEKVVKEEANTSKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQ
LLVGTNEATVRDDVSNFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDM
SFIKDTEKILRLLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNY
CVVNPAEKLQLLVSILNNYKFKKCIVYFPTCVSVSYFYSFIQYLGKRNILVNEVEIFSLH
GKLQTSARTKTLTAFTDSLSNSVLFTTDVAARGIDIPDVDLVIQLDPPTNTDMFMHRCGR
TGRANRVGKAITFLNEGREEDFIPFMQVKNVELEELDLEVKGITTNFYEDFRNWILEDRD
RFDKGVKAYVAFIKYYSNHSATSIFRLQSLDYVGIAKLYGLFRLPRMPEITKYLATEKQE
GIFPGNWLVDPPVNMDEYKYKDKKREKERQETLKNISLINDKKKLKSELKKKNLAWSDKT
LTKERKLERKEKMSLKRKAIEEELKAEELDENAEEERIKEDWKEIVLQNKRKKVSSKAIQ
GNFDDL
Download sequence
Identical sequences A7A237 P25808
YFL002C 4932.YFL002C YFL002C YFL002C YFL002C YFL002C sp|A7A237|SPB4_YEAS7 YFL002C YFL002C

Jump to [ Top of page · Domain architecture · Domain assignment details ]