SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFL015W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YFL015W-A   Protein: S000028765
Sequence length 105
Comment YFL015W-A SGDID:S000028765, Chr VI from 106409-106726, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MIKKSRTYYPSFGAYFHLLPAHPNAHSVTLLFGIFRSSPFLLLFLLIHRKVGEGRGSQRM
KKKRGRANPSENLRERADPTNGPAENGKKGSVMCGCQLAVAMTTC
Download sequence
Identical sequences YFL015W-A YFL015W-A 4932.YFL015W-A YFL015W-A YFL015W-A YFL015W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]