SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YFL015W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YFL015W-A   Protein: S000028765
Sequence length 105
Comment YFL015W-A SGDID:S000028765, Chr VI from 106409-106726, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MIKKSRTYYPSFGAYFHLLPAHPNAHSVTLLFGIFRSSPFLLLFLLIHRKVGEGRGSQRM
KKKRGRANPSENLRERADPTNGPAENGKKGSVMCGCQLAVAMTTC
Download sequence
Identical sequences YFL015W-A 4932.YFL015W-A YFL015W-A YFL015W-A YFL015W-A YFL015W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]