SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YFL039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL039C
Domain Number 1 Region: 147-375
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.64e-99
Family Actin/HSP70 0.00000000109
Further Details:      
 
Domain Number 2 Region: 4-153
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.32e-67
Family Actin/HSP70 0.0000000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin filament 2.158 18.3
cation channel complex 2.038 15.97
SWI/SNF superfamily-type complex 2.177 14.97
endoplasmic reticulum part 1.429 14.05
nuclear chromosome 1.723 13.94
chromosomal part 1.478 13.94
chromatin 1.906 13.94
cilium 1.61 13.72
cilium part 1.917 13.72
microtubule cytoskeleton 1.333 8.5

Protein sequence

External link(s) Locus: YFL039C   Protein: S000001855
Sequence length 375
Comment ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions"
Sequence
MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS
KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMT
QIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDL
AGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSY
ELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS
GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQ
EYDESGPSIVHHKCF
Download sequence
Identical sequences A7A200 B3LUH2 C8Z7P3 G2WDA2 G8ZQZ4 N1PA17 P60009 P60010 P60011 W7PHN0 W7RKW5
tr|A7A200|A7A200_YEAS7 YFL039C 1yag.A YFL039C 1yagA YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C gnl|GLV|CAGL0K12694g YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C SCRT_05509 4932.YFL039C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]