SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFL039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL039C
Domain Number 1 Region: 147-375
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.64e-99
Family Actin/HSP70 0.00000000109
Further Details:      
 
Domain Number 2 Region: 4-153
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.32e-67
Family Actin/HSP70 0.0000000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell-substrate junction 1.489 30.57
actin-based cell projection 1.624 25.63
cell leading edge 1.401 20.51
chromosomal part 1.471 16.54
nuclear chromosome 1.727 16.54
nuclear chromatin 2.17 16.54
cell body 1.528 14.72
transporter complex 1.657 14.67
actin cytoskeleton 1.39 14.37
endoplasmic reticulum part 1.329 13.24

Protein sequence

External link(s) Locus: YFL039C   Protein: S000001855
Sequence length 375
Comment ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions"
Sequence
MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS
KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMT
QIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDL
AGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSY
ELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS
GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQ
EYDESGPSIVHHKCF
Download sequence
Identical sequences A7A200 B3LUH2 C8Z7P3 G2WDA2 G8ZQZ4 N1PA17 P60009 P60010 P60011 W7PHN0 W7RKW5
YFL039C YFL039C 1yag.A YFL039C 1yagA YFL039C YFL039C YFL039C YFL039C gnl|GLV|CAGL0K12694g tr|A7A200|A7A200_YEAS7 SCRT_05509 YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C 4932.YFL039C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]