SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFL039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL039C
Domain Number 1 Region: 147-375
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.64e-99
Family Actin/HSP70 1.09e-09
Further Details:      
 
Domain Number 2 Region: 4-153
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.32e-67
Family Actin/HSP70 9.69e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YFL039C   Protein: S000001855
Sequence length 375
Comment ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions"
Sequence
MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQS
KRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMT
QIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDL
AGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSY
ELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS
GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQ
EYDESGPSIVHHKCF
Download sequence
Identical sequences A7A200 B3LUH2 C8Z7P3 G2WDA2 G8ZQZ4 P60009 P60010 P60011
YFL039C 1yagA YFL039C gnl|GLV|CAGL0K12694g YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C YFL039C 4932.YFL039C YFL039C SCRT_05509 YFL039C YFL039C tr|A7A200|A7A200_YEAS7 1yag.A YFL039C YFL039C YFL039C YFL039C

Jump to [ Top of page · Domain architecture · Domain assignment details ]