SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFL061W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL061W
Domain Number 1 Region: 34-188
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 8.57e-19
Family HD domain 0.018
Further Details:      
 

Protein sequence

External link(s) Locus: YFL061W   Protein: S000001833
Sequence length 225
Comment YFL061W SGDID:S000001833, Chr VI from 9545-10222, Uncharacterized ORF, "Protein whose expression is induced by DNA damage"
Sequence
MSQYGFVRVPREVEKAIPVVNAPRPRAVVPPPNSETARLVREYAAKELTAPVLNHSLRVF
QYSVAIIRDQFPAWDLDQEVLYVTCLLHDIATTDKNMRATKMSFEYYGGILSRELVFNAT
GGNQDYADAVTEAIIRHQDLTGTGYITTLGLILQIATTLDNVGSNTDLIHIDTVSAINEQ
FPRLHWLSCFATVVDTENSRKPWGHTSSLGDDFSKKVICNTFGYN
Download sequence
Identical sequences B5VQ88 C8ZBV9 P0CH63 P0CH64
YFL061W YNL335W YFL061W YNL335W 4932.YFL061W 4932.YNL335W YFL061W YNL335W YFL061w YT285 YFL061W YNL335W

Jump to [ Top of page · Domain architecture · Domain assignment details ]