SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFL063W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YFL063W
Domain Number - Region: 64-102
Classification Level Classification E-value
Superfamily YbiA-like 0.0144
Family YbiA-like 0.038
Further Details:      
 

Protein sequence

External link(s) Locus: YFL063W   Protein: S000001831
Sequence length 151
Comment YFL063W SGDID:S000001831, Chr VI from 5066-5521, Dubious ORF, "Dubious open reading frame, based on available experimental and comparative sequence data"
Sequence
MIVNNAHILTLPIPYHAPSVILTITCILIRHTHTDATIVYTISTYPTFTFHSMAHLSLHE
YKCTHIIMHGTCLSGLYPVPFTHNSHYYPHFNIYILFRGPKYCINALNTYVIPLFHRILT
TQFIYTYANITKKSPLKSPKHKNILSFNNNT
Download sequence
Identical sequences P43541
YFL063W YFL063W 4932.YFL063W YFL063W YFL063W

Jump to [ Top of page · Domain architecture · Domain assignment details ]