SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFL063W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YFL063W
Domain Number - Region: 64-102
Classification Level Classification E-value
Superfamily YbiA-like 0.0144
Family YbiA-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YFL063W   Protein: S000001831
Sequence length 151
Comment YFL063W SGDID:S000001831, Chr VI from 5066-5521, Dubious ORF, "Dubious open reading frame, based on available experimental and comparative sequence data"
Sequence
MIVNNAHILTLPIPYHAPSVILTITCILIRHTHTDATIVYTISTYPTFTFHSMAHLSLHE
YKCTHIIMHGTCLSGLYPVPFTHNSHYYPHFNIYILFRGPKYCINALNTYVIPLFHRILT
TQFIYTYANITKKSPLKSPKHKNILSFNNNT
Download sequence
Identical sequences P43541
YFL063W YFL063W 4932.YFL063W YFL063W YFL063W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]