SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR008W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YFR008W
Domain Number - Region: 10-36
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00523
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YFR008W   Protein: S000001904
Sequence length 221
Comment FAR7 SGDID:S000001904, Chr VI from 160529-161194, Verified ORF, "Protein involved in G1 cell cycle arrest in response to pheromone, in a pathway different from the Far1p-dependent pathway; interacts with Far3p, Far8p, Far9p, Far10p, and Far11p"
Sequence
MSDQINVLSMQQQQQQQQQQQQVYMSPQAENLNHMYLLVNKLVKQLRENQAEKAKILRNI
DILSGSLNKYETSEEPHDTTENIALFNRFLEQRGKAPITEKEQLSNNLDENAKDDVMLGV
LKRQNSMLRKSLQESKQVTLESMDLLSYSEDSLNYIVAQLRGNILMHHKETIKLIRQKFQ
TETIPLEDEEFKMYLENVNGLQKLTDISHTYRLLLRLHAQD
Download sequence
Identical sequences G2WDE7 P43592
YFR008W 4932.YFR008W YFR008W YFR008W YFR008W YFR008W YFR008W YFR008W YT286 YFR008W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]