SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR008W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YFR008W
Domain Number - Region: 10-36
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00523
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Protein sequence

External link(s) Locus: YFR008W   Protein: S000001904
Sequence length 221
Comment FAR7 SGDID:S000001904, Chr VI from 160529-161194, Verified ORF, "Protein involved in G1 cell cycle arrest in response to pheromone, in a pathway different from the Far1p-dependent pathway; interacts with Far3p, Far8p, Far9p, Far10p, and Far11p"
Sequence
MSDQINVLSMQQQQQQQQQQQQVYMSPQAENLNHMYLLVNKLVKQLRENQAEKAKILRNI
DILSGSLNKYETSEEPHDTTENIALFNRFLEQRGKAPITEKEQLSNNLDENAKDDVMLGV
LKRQNSMLRKSLQESKQVTLESMDLLSYSEDSLNYIVAQLRGNILMHHKETIKLIRQKFQ
TETIPLEDEEFKMYLENVNGLQKLTDISHTYRLLLRLHAQD
Download sequence
Identical sequences G2WDE7 P43592
YFR008W 4932.YFR008W YFR008W YFR008W YFR008W YFR008W YFR008W YT286 YFR008W YFR008W

Jump to [ Top of page · Domain architecture · Domain assignment details ]