SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR010W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YFR010W-A   Protein: S000028824
Sequence length 62
Comment YFR010W-A SGDID:S000028824, Chr VI from 166721-166909, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the uncharacterized gene YFR011C; identified by expression profiling and mass spectrometry"
Sequence
MYTFSYSTHNELLEFFHLFVTIQWLALIGQKTLSQFCLYRNAAVVGFFIRFTFGTPIFLQ
LL
Download sequence
Identical sequences C8Z7U5 P0C5N0
YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A 4932.YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]