SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YFR010W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YFR010W-A   Protein: S000028824
Sequence length 62
Comment YFR010W-A SGDID:S000028824, Chr VI from 166721-166909, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the uncharacterized gene YFR011C; identified by expression profiling and mass spectrometry"
Sequence
MYTFSYSTHNELLEFFHLFVTIQWLALIGQKTLSQFCLYRNAAVVGFFIRFTFGTPIFLQ
LL
Download sequence
Identical sequences C8Z7U5 P0C5N0 W7PU57
YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A 4932.YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A YFR010W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]