SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR016C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR016C
Domain Number 1 Region: 1135-1229
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000173
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
endoplasmic reticulum lumen 2.107 22.21
sperm part 2.197 20.39
transferase complex 1.423 16.46
plastid 1.6 9.15
endoplasmic reticulum part 1.431 8.44
side of membrane 1.701 7.99
sarcoplasmic reticulum 1.986 7.48
cilium 1.573 7.18
ciliary part 1.844 7.18
oxidoreductase complex 1.872 6.36

Protein sequence

External link(s) Locus: YFR016C   Protein: S000001912
Sequence length 1233
Comment YFR016C SGDID:S000001912, Chr VI from 180735-177034, reverse complement, Verified ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and bud; interacts with Spa2p; YFL016C is not an essential gene"
Sequence
MVESLTVENQEHNVQPPSVTSAGDSYSTLATDLPLPSTNDIIESRDQLTESDLDEAINAT
ENFAQELSSQRKSSKLKGHKKKNQGQIKANRDRDTIVKLSSSVGETEEASTRDAISHDLE
RKDDVIEIATDTINDATESPTQIPIDVNVVIKETSTNNVAEGTENVPPIKESTGIEVGNS
PITRRKKNKKKKTTNRRGRNSSNPADTTDLSKQSTLDSILVGIEEYLQEDGSKNEDIKVN
IVQDEPVNVEKMDIRTRNESSDKTFDIDVPNKDNVDETSSKSENNINEEKAEHTLPREEN
EILNVNEGNAASFKHQLEPHGLEAGDENGQASTKDVESESLTKNGFNFKENESKHLKAGE
KQQTESDRDGISPSVLAKNQKETEIGKEDHVFEQKDKEDEKCRKELSVNHENNMSHNFNA
AGSDSIIPPETERETYDDETMGPTKRISDNEKNLQHGTNDISVEVEKEEEEEEEEEENST
FSKVKKENVTGEQEAVRNNEVSGTEEESTSKGEEIMGGDEKQSEAGEKSSIIEIEGSANS
AKISKDNLVLEDEAEAPTQENKPTEVVGEIDIPDAPRDDVEIVEAVEKNIIPEDLEVAKE
DQEGEQVKLDEPVKAMKDDKIAMRGAESISEDMKKKQEGTAELSNEKAKKEVDETARESA
EGVEVEKSKTPESPKVVKRCTSGRPEDLQINERDPEVLKEDVRVPDEDVKPEIATTIENS
EEEDPKSQRVQISTEQAETTQKDMGDVGSTTSFKEEEKPKRFEITQEGDKITGKDTNHEH
GEATEAASENSKASDVGTAEKYIEPSSESVKKDTEEDAEVENSEKTEFIKVKAELENLDA
PKEAEVTAELNKENEDVEVDTEEDAEVENSEKTEFIKVKAELGNLDAPKEAEVTAELNKE
NEDVEVAATSKEDIETKCSEPAETPIEDGTCTEAEVSKKDAEAVTKEDENMENSKIAEAL
KDVTGDQEIDDINISDEFQRTVELPELEKQDIKDNKGEDKELEVEETEKETSLPDLVVEE
NITEEKNEIKQEEEEVSQLDFNETESISKEAPNNDENGFEDQSTRENPKKASADDIFKDI
LDETNEFLEQLKIVDDSELNALLQSLDAKDSTTQTTEQSKKNNDKPQDVITTSEIRKLNE
KEPVYIYTSLAGGGFHMIPRTNRLSTILTANRIPFTYRDLGTDDEARKVWKTFSKGRSLP
GVVRGHNDLIGNWEEIEEANEDYKLRELIYDTI
Download sequence
Identical sequences P43597
4932.YFR016C YFR016C YFR016C YR228 YFR016C YFR016C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]