SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR016C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR016C
Domain Number 1 Region: 1135-1229
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-13
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.038
Further Details:      
 

Protein sequence

External link(s) Locus: YFR016C   Protein: S000001912
Sequence length 1233
Comment YFR016C SGDID:S000001912, Chr VI from 180735-177034, reverse complement, Verified ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and bud; interacts with Spa2p; YFL016C is not an essential gene"
Sequence
MVESLTVENQEHNVQPPSVTSAGDSYSTLATDLPLPSTNDIIESRDQLTESDLDEAINAT
ENFAQELSSQRKSSKLKGHKKKNQGQIKANRDRDTIVKLSSSVGETEEASTRDAISHDLE
RKDDVIEIATDTINDATESPTQIPIDVNVVIKETSTNNVAEGTENVPPIKESTGIEVGNS
PITRRKKNKKKKTTNRRGRNSSNPADTTDLSKQSTLDSILVGIEEYLQEDGSKNEDIKVN
IVQDEPVNVEKMDIRTRNESSDKTFDIDVPNKDNVDETSSKSENNINEEKAEHTLPREEN
EILNVNEGNAASFKHQLEPHGLEAGDENGQASTKDVESESLTKNGFNFKENESKHLKAGE
KQQTESDRDGISPSVLAKNQKETEIGKEDHVFEQKDKEDEKCRKELSVNHENNMSHNFNA
AGSDSIIPPETERETYDDETMGPTKRISDNEKNLQHGTNDISVEVEKEEEEEEEEEENST
FSKVKKENVTGEQEAVRNNEVSGTEEESTSKGEEIMGGDEKQSEAGEKSSIIEIEGSANS
AKISKDNLVLEDEAEAPTQENKPTEVVGEIDIPDAPRDDVEIVEAVEKNIIPEDLEVAKE
DQEGEQVKLDEPVKAMKDDKIAMRGAESISEDMKKKQEGTAELSNEKAKKEVDETARESA
EGVEVEKSKTPESPKVVKRCTSGRPEDLQINERDPEVLKEDVRVPDEDVKPEIATTIENS
EEEDPKSQRVQISTEQAETTQKDMGDVGSTTSFKEEEKPKRFEITQEGDKITGKDTNHEH
GEATEAASENSKASDVGTAEKYIEPSSESVKKDTEEDAEVENSEKTEFIKVKAELENLDA
PKEAEVTAELNKENEDVEVDTEEDAEVENSEKTEFIKVKAELGNLDAPKEAEVTAELNKE
NEDVEVAATSKEDIETKCSEPAETPIEDGTCTEAEVSKKDAEAVTKEDENMENSKIAEAL
KDVTGDQEIDDINISDEFQRTVELPELEKQDIKDNKGEDKELEVEETEKETSLPDLVVEE
NITEEKNEIKQEEEEVSQLDFNETESISKEAPNNDENGFEDQSTRENPKKASADDIFKDI
LDETNEFLEQLKIVDDSELNALLQSLDAKDSTTQTTEQSKKNNDKPQDVITTSEIRKLNE
KEPVYIYTSLAGGGFHMIPRTNRLSTILTANRIPFTYRDLGTDDEARKVWKTFSKGRSLP
GVVRGHNDLIGNWEEIEEANEDYKLRELIYDTI
Download sequence
Identical sequences P43597
YFR016C 4932.YFR016C YFR016C YR228 YFR016C YFR016C

Jump to [ Top of page · Domain architecture · Domain assignment details ]