SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR021W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR021W
Domain Number 1 Region: 7-153,224-324
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.62e-32
Family WD40-repeat 0.01
Further Details:      
 

Protein sequence

External link(s) Locus: YFR021W   Protein: S000001917
Sequence length 500
Comment ATG18 SGDID:S000001917, Chr VI from 194800-196302, Verified ORF, "Phosphoinositide binding protein required for vesicle formation in autophagy and the cytoplasm-to-vacuole targeting (Cvt) pathway; binds both phosphatidylinositol (3,5)-bisphosphate and phosphatidylinositol 3-phosphate; WD-40 repeat protein"
Sequence
MSDSSPTINFINFNQTGTCISLGTSKGFKIFNCEPFGKFYSEDSGGYAIVEMLFSTSLLA
LVGIGDQPALSPRRLRIINTKKHSIICEVTFPTSILSVKMNKSRLVVLLQEQIYIYDINT
MRLLHTIETNPNPRGLMAMSPSVANSYLVYPSPPKVINSEIKAHATTNNITLSVGGNTET
SFKRDQQDAGHSDISDLDQYSSFTKRDDADPTSSNGGNSSIIKNGDVIVFNLETLQPTMV
IEAHKGEIAAMAISFDGTLMATASDKGTIIRVFDIETGDKIYQFRRGTYATRIYSISFSE
DSQYLAVTGSSKTVHIFKLGHSMSNNKLDSDDSNMEEAAADDSSLDTTSIDALSDEENPT
RLAREPYVDASRKTMGRMIRYSSQKLSRRAARTLGQIFPIKVTSLLESSRHFASLKLPVE
TNSHVMTISSIGSPIDIDTSEYPELFETGNSASTESYHEPVMKMVPIRVVSSDGYLYNFV
MDPERGGDCLILSQYSILMD
Download sequence
Identical sequences A7A258 B3LUN0 C7GYC6 C8Z7V6 P43601 W7RL09
YFR021W YFR021W 4932.YFR021W YFR021W YFR021W YFR021W SCRT_05569 YFR021W YFR021W sp|A7A258|ATG18_YEAS7 YFR021W YFR021W 355320 YR279 YFR021W

Jump to [ Top of page · Domain architecture · Domain assignment details ]