SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR021W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR021W
Domain Number 1 Region: 7-153,224-324
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.62e-32
Family WD40-repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YFR021W   Protein: S000001917
Sequence length 500
Comment ATG18 SGDID:S000001917, Chr VI from 194800-196302, Verified ORF, "Phosphoinositide binding protein required for vesicle formation in autophagy and the cytoplasm-to-vacuole targeting (Cvt) pathway; binds both phosphatidylinositol (3,5)-bisphosphate and phosphatidylinositol 3-phosphate; WD-40 repeat protein"
Sequence
MSDSSPTINFINFNQTGTCISLGTSKGFKIFNCEPFGKFYSEDSGGYAIVEMLFSTSLLA
LVGIGDQPALSPRRLRIINTKKHSIICEVTFPTSILSVKMNKSRLVVLLQEQIYIYDINT
MRLLHTIETNPNPRGLMAMSPSVANSYLVYPSPPKVINSEIKAHATTNNITLSVGGNTET
SFKRDQQDAGHSDISDLDQYSSFTKRDDADPTSSNGGNSSIIKNGDVIVFNLETLQPTMV
IEAHKGEIAAMAISFDGTLMATASDKGTIIRVFDIETGDKIYQFRRGTYATRIYSISFSE
DSQYLAVTGSSKTVHIFKLGHSMSNNKLDSDDSNMEEAAADDSSLDTTSIDALSDEENPT
RLAREPYVDASRKTMGRMIRYSSQKLSRRAARTLGQIFPIKVTSLLESSRHFASLKLPVE
TNSHVMTISSIGSPIDIDTSEYPELFETGNSASTESYHEPVMKMVPIRVVSSDGYLYNFV
MDPERGGDCLILSQYSILMD
Download sequence
Identical sequences A7A258 B3LUN0 C7GYC6 C8Z7V6 P43601 W7RL09
sp|A7A258|ATG18_YEAS7 YFR021W YFR021W YFR021W YFR021W YFR021W 355320 YR279 YFR021W YFR021W YFR021W SCRT_05569 YFR021W YFR021W 4932.YFR021W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]