SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR027W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR027W
Domain Number 1 Region: 138-235
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000667
Family N-acetyl transferase, NAT 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.496 14.86
transferase complex 1.423 14.66
perinuclear region of cytoplasm 1.467 5.73
chromosomal part 1.477 4.56
nuclear chromosome 1.73 4.56
chromatin 1.822 4.56

Protein sequence

External link(s) Locus: YFR027W   Protein: S000001923
Sequence length 281
Comment ECO1 SGDID:S000001923, Chr VI from 207440-208285, Verified ORF, "Acetyltransferase required for the establishment of sister chromatid cohesion during DNA replication and in response to double-strand breaks; also required for postreplicative double-strand break repair"
Sequence
MKARKSQRKAGSKPNLIQSKLQVNNGSKSNKIVKCDKCEMSYSSTSIEDRAIHEKYHTLQ
LHGRKWSPNWGSIVYTERNHSRTVHLSRSTGTITPLNSSPLKKSSPSITHQEEKIVYVRP
DKSNGEVRAMTEIMTLVNNELNAPHDENVIWNSTTEEKGKAFVYIRNDRAVGIIIIENLY
GGNGKTSSRGRWMVYDSRRLVQNVYPDFKIGISRIWVCRTARKLGIATKLIDVARENIVY
GEVIPRYQVAWSQPTDSGGKLASKYNGIMHKSGKLLLPVYI
Download sequence
Identical sequences G2WDG5 P43605
YFR027W 4932.YFR027W YFR027W YFR027W YFR027W YFR027W YFR027W 355322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]