SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR027W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR027W
Domain Number 1 Region: 138-235
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.67e-05
Family N-acetyl transferase, NAT 0.03
Further Details:      
 

Protein sequence

External link(s) Locus: YFR027W   Protein: S000001923
Sequence length 281
Comment ECO1 SGDID:S000001923, Chr VI from 207440-208285, Verified ORF, "Acetyltransferase required for the establishment of sister chromatid cohesion during DNA replication and in response to double-strand breaks; also required for postreplicative double-strand break repair"
Sequence
MKARKSQRKAGSKPNLIQSKLQVNNGSKSNKIVKCDKCEMSYSSTSIEDRAIHEKYHTLQ
LHGRKWSPNWGSIVYTERNHSRTVHLSRSTGTITPLNSSPLKKSSPSITHQEEKIVYVRP
DKSNGEVRAMTEIMTLVNNELNAPHDENVIWNSTTEEKGKAFVYIRNDRAVGIIIIENLY
GGNGKTSSRGRWMVYDSRRLVQNVYPDFKIGISRIWVCRTARKLGIATKLIDVARENIVY
GEVIPRYQVAWSQPTDSGGKLASKYNGIMHKSGKLLLPVYI
Download sequence
Identical sequences G2WDG5 P43605
YFR027W 4932.YFR027W YFR027W YFR027W YFR027W 355322 YFR027W YFR027W

Jump to [ Top of page · Domain architecture · Domain assignment details ]