SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFR031C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR031C-A
Domain Number 1 Region: 99-245
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.01e-50
Family C-terminal domain of ribosomal protein L2 0.0000113
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.51e-18
Family Cold shock DNA-binding domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.138 52.55
replication fork 2.17 36.28
chromosomal region 1.966 30.26
protein-DNA complex 1.891 25.87
aminoacyl-tRNA synthetase multienzyme complex 2.17 24.91
nuclear chromosome part 1.803 23.69
ribosomal subunit 1.939 22.18
chromosomal part 1.456 22.05
intracellular ribonucleoprotein complex 1.329 20.24
transferase complex 1.334 12.64

Protein sequence

External link(s) Locus: YFR031C-A   Protein: S000002104
Sequence length 254
Comment RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins"
Sequence
MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAK
VVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKP
GDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLL
KAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAA
RRTGLLRGSQKTQD
Download sequence
Identical sequences A0A0L8VR97 A6ZVP9 B3LUP0 C8Z7W6 G2WGC6 N1P6U2 P0CX45 P0CX46
YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YFR031C-A YIL018W YFR031C-A YIL018w___KOG2309 4932.YFR031C-A 4932.YIL018W YFR031C-A SCRT_05580 YFR031C-A tr|A6ZVP9|A6ZVP9_YEAS7 YFR031C-A YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YFR031C-A YIL018W 3j6x.L2 3j6y.L2 3j77.L2 3j78.L2 3jct.A 4v6i.BB 4v7f.B 4v7r.BB 4v7r.DB 4v88.BA 4v88.DA 4v8t.A 4v91.A 5apn.A 5apo.A 5fl8.A 5gak.E 5jcs.A 5juo.F 5jup.F 5jus.F 5jut.F 5juu.F 5mc6.AW 5t62.D 5t6r.D YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]