SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFR031C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR031C-A
Domain Number 1 Region: 99-245
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.01e-50
Family C-terminal domain of ribosomal protein L2 0.0000113
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.51e-18
Family Cold shock DNA-binding domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.127 52.82
replication fork 2.242 37.57
protein-DNA complex 2.242 33.98
chromosomal region 1.935 31.1
nuclear chromosome 1.727 23.98
chromosomal part 1.471 22.3
ribosomal subunit 1.948 22.06
intracellular ribonucleoprotein complex 1.323 19.98
nucleoplasm part 1.424 12.33
cytosolic ribosome 2.062 9.5

Protein sequence

External link(s) Locus: YFR031C-A   Protein: S000002104
Sequence length 254
Comment RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins"
Sequence
MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAK
VVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKP
GDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLL
KAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAA
RRTGLLRGSQKTQD
Download sequence
Identical sequences A6ZVP9 B3LUP0 C8Z7W6 G2WGC6 N1P6U2 P0CX45 P0CX46 W7PLF7 W7RFQ4
tr|A6ZVP9|A6ZVP9_YEAS7 YFR031C-A YIL018W YFR031C-A YIL018W YIL018w___KOG2309 YFR031C-A YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YFR031C-A YFR031C-A YFR031C-A YIL018W 4932.YFR031C-A 4932.YIL018W YFR031C-A YIL018W 1vw8.B 1vwu.B 1vxv.B 1vxy.B 3izc.B 3izs.B 3j65.B 3o58.B 3o5h.B 3u5e.A 3u5i.A 4b6a.A 4cuw.A YFR031C-A YIL018W SCRT_05580 YFR031C-A YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]