SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR031C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR031C-A
Domain Number 1 Region: 99-245
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.01e-50
Family C-terminal domain of ribosomal protein L2 0.0000113
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.51e-18
Family Cold shock DNA-binding domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
DNA replication 1.891 48.73
DNA duplex unwinding 1.985 47.01
double-strand break repair 1.882 44.57
tRNA aminoacylation 2.003 38.49
translation 1.518 35.28
DNA repair 1.506 32.47
telomere organization 2.075 26.4
mRNA metabolic process 1.622 21.42
positive regulation of cellular catabolic process 1.376 21.42
RNA processing 1.457 21.42
Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 55.26
nucleoplasm part 1.496 33.77
replication fork 2.208 33.63
chromosomal part 1.477 22.68
ribonucleoprotein complex 1.414 20.38
ribosomal subunit 2.011 19.55
transferase complex 1.423 12.34
DNA repair complex 2.141 10.11
chromosomal region 1.98 9.54
nuclear chromosome 1.73 8.97

Protein sequence

External link(s) Locus: YFR031C-A   Protein: S000002104
Sequence length 254
Comment RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins"
Sequence
MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAK
VVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPLGSVPEGTIVSNVEEKP
GDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLL
KAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAA
RRTGLLRGSQKTQD
Download sequence
Identical sequences A6ZVP9 B3LUP0 C8Z7W6 G2WGC6 N1P6U2 P0CX45 P0CX46 W7PLF7 W7RFQ4
YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A tr|A6ZVP9|A6ZVP9_YEAS7 YIL018w___KOG2309 YFR031C-A YIL018W YFR031C-A YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YIL018W YFR031C-A YFR031C-A YFR031C-A 4932.YFR031C-A 4932.YIL018W YFR031C-A YIL018W SCRT_05580 YFR031C-A YIL018W 1vw8.B 1vwu.B 1vxv.B 1vxy.B 3izc.B 3izs.B 3j65.B 3o58.B 3o5h.B 3u5e.A 3u5i.A 4b6a.A 4cuw.A YFR031C-A YIL018W YFR031C-A YFR031C-A YIL018W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]