SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR033C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR033C
Domain Number 1 Region: 74-147
Classification Level Classification E-value
Superfamily Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.57e-24
Family Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 6.51e-06
Further Details:      
 
Weak hits

Sequence:  YFR033C
Domain Number - Region: 37-90
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.0102
Family Sigma2 domain of RNA polymerase sigma factors 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
mitochondrial inner membrane 1.752 27.06
respiratory chain 2.141 23.57
mitochondrial envelope 1.571 22.94
organelle inner membrane 1.673 17.77
mitochondrial membrane part 1.917 8.22
Biological Process IC (bits) H-Score
cellular respiration 1.868 26.06
generation of precursor metabolites and energy 1.507 19.3
oxidation-reduction process 1.416 13.16
electron transport chain 2.197 5.02

Protein sequence

External link(s) Locus: YFR033C   Protein: S000001929
Sequence length 147
Comment QCR6 SGDID:S000001929, Chr VI from 224757-224314, reverse complement, Verified ORF, "Subunit 6 of the ubiquinol cytochrome-c reductase complex, which is a component of the mitochondrial inner membrane electron transport chain; highly acidic protein; required for maturation of cytochrome c1"
Sequence
MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDD
DDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHK
EDCVEEFFHLQHYLDTATAPRLFDKLK
Download sequence
Identical sequences A7A273 B3LUP4 C8Z7X0 N1P520 P00127 W7Q4I6 W7RC81
YFR033C YFR033C YFR033C YFR033C YFR033C YFR033C YFR033C 4932.YFR033C YFR033C SCRT_05584 YFR033C tr|A7A273|A7A273_YEAS7 YFR033C YFR033C YFR033C YFR033C YFR033C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]