SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR033C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR033C
Domain Number 1 Region: 74-147
Classification Level Classification E-value
Superfamily Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.57e-24
Family Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 6.51e-06
Further Details:      
 
Weak hits

Sequence:  YFR033C
Domain Number - Region: 37-90
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.0102
Family Sigma2 domain of RNA polymerase sigma factors 0.012
Further Details:      
 

Protein sequence

External link(s) Locus: YFR033C   Protein: S000001929
Sequence length 147
Comment QCR6 SGDID:S000001929, Chr VI from 224757-224314, reverse complement, Verified ORF, "Subunit 6 of the ubiquinol cytochrome-c reductase complex, which is a component of the mitochondrial inner membrane electron transport chain; highly acidic protein; required for maturation of cytochrome c1"
Sequence
MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDD
DDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHK
EDCVEEFFHLQHYLDTATAPRLFDKLK
Download sequence
Identical sequences A7A273 B3LUP4 C8Z7X0 N1P520 P00127 W7Q4I6 W7RC81
YFR033C YFR033C YFR033C YFR033C YFR033C YFR033C YFR033C 4932.YFR033C YFR033C SCRT_05584 YFR033C tr|A7A273|A7A273_YEAS7 YFR033C YFR033C YFR033C YFR033C YFR033C

Jump to [ Top of page · Domain architecture · Domain assignment details ]