SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFR033C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR033C
Domain Number 1 Region: 74-147
Classification Level Classification E-value
Superfamily Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.57e-24
Family Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000651
Further Details:      
 
Weak hits

Sequence:  YFR033C
Domain Number - Region: 37-90
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.0102
Family Sigma2 domain of RNA polymerase sigma factors 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
respiratory chain complex 2.067 74.28
oxidoreductase complex 1.828 19.57
transporter complex 1.698 17.75
organelle envelope 1.405 8.92
mitochondrial respiratory chain 2.143 4.9
inner mitochondrial membrane protein complex 1.946 4.26

Protein sequence

External link(s) Locus: YFR033C   Protein: S000001929
Sequence length 147
Comment QCR6 SGDID:S000001929, Chr VI from 224757-224314, reverse complement, Verified ORF, "Subunit 6 of the ubiquinol cytochrome-c reductase complex, which is a component of the mitochondrial inner membrane electron transport chain; highly acidic protein; required for maturation of cytochrome c1"
Sequence
MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDD
DDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHK
EDCVEEFFHLQHYLDTATAPRLFDKLK
Download sequence
Identical sequences A0A0L8VRH4 A7A273 B3LUP4 C8Z7X0 N1P520 P00127
YFR033C YFR033C YFR033C YFR033C YFR033C YFR033C YFR033C SCRT_05584 YFR033C YFR033C YFR033C YFR033C tr|A7A273|A7A273_YEAS7 YFR033C YFR033C YFR033C 4932.YFR033C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]