SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR036W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YFR036W-A   Protein: S000028767
Sequence length 216
Comment YFR036W-A SGDID:S000028767, Chr VI from 227438-228088, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene RSC8"
Sequence
MTIVHFVGSLFFFFFFSYIFFYNDHGLYTWGCNFAMESPSPTSSPSLPTRFTPCPVAVLP
SSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFRSRICLLSDNRSFSIFSDSFTYF
SFSISSCVSRSHSFVNLLSNFSMVSLTNSWIIAWLSSMYFSEISLDLSETLPNLSSPCSS
VWTASFTHSINFEPDTLPSRLSPPLPFSVEPTTSRM
Download sequence
Identical sequences YFR036W-A 4932.YFR036W-A YFR036W-A YFR036W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]