SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR037C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR037C
Domain Number 1 Region: 75-181
Classification Level Classification E-value
Superfamily Homeodomain-like 8.6e-33
Family SWIRM domain 0.00013
Further Details:      
 
Domain Number 2 Region: 314-364
Classification Level Classification E-value
Superfamily Homeodomain-like 1.96e-09
Family Myb/SANT domain 0.067
Further Details:      
 
Domain Number 3 Region: 249-295
Classification Level Classification E-value
Superfamily RING/U-box 1.53e-05
Family ZZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transcription factor complex 1.881 44.01
nucleoplasm part 1.419 35.1
ubiquitin ligase complex 1.933 32.55
SWI/SNF superfamily-type complex 2.177 21.83
ribonucleoprotein complex 1.415 21.15
vacuolar part 1.621 16.14
chromosomal part 1.478 14.27
integral to plasma membrane 1.469 14.05
receptor complex 1.51 14.05
microbody 1.955 11.91

Protein sequence

External link(s) Locus: YFR037C   Protein: S000001933
Sequence length 557
Comment RSC8 SGDID:S000001933, Chr VI from 229173-227500, reverse complement, Verified ORF, "Component of the RSC chromatin remodeling complex; essential for viability and mitotic growth; homolog of SWI/SNF subunit Swi3p, but unlike Swi3p, does not activate transcription of reporters"
Sequence
MSDTEKDKDVPMVDSHEATEEPPTTSTNTPSFPHLAQEQAKEESATLGAEVAHKKINYEQ
EAQKLEEKALRFLAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKD
TRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSLIG
PSFTGHFQVVLDTPQGLKPFLPENVIKQEVEGGDGAEPQVKKEFPVNLTIKKNVYDSAQD
FNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSD
FIRLENNGNSVKKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIE
DNYIREVVGSTLNGKGGDSRDGSVSGSKLMECVNDAVQTLLQGDDKLGKVSDKSREISEK
YIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLSLSKQIL
DLNKSLEELNVSKKLVLISEQVDSGIQLVEKDQEGDDEDGNTATGHGVKRVGKEGEEVGE
GDSIAKLQPQVYKPWSL
Download sequence
Identical sequences N1P3A7 P43609
YFR037C YFR037C 4932.YFR037C YFR037C YFR037C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]