SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YFR037C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR037C
Domain Number 1 Region: 75-181
Classification Level Classification E-value
Superfamily Homeodomain-like 8.6e-33
Family SWIRM domain 0.00013
Further Details:      
 
Domain Number 2 Region: 314-364
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000196
Family Myb/SANT domain 0.067
Further Details:      
 
Domain Number 3 Region: 249-295
Classification Level Classification E-value
Superfamily RING/U-box 0.0000153
Family ZZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
intracellular ribonucleoprotein complex 1.368 22.05
protein-DNA complex 1.923 18.12
integral component of plasma membrane 1.428 17.53
receptor complex 1.469 17.53
plasma membrane receptor complex 1.824 17.53
cytoplasmic vesicle part 1.417 13.87
chromosomal part 1.512 12.74
nucleoplasm part 1.369 11.17
ATPase complex 2.002 11.05
cytoplasmic ribonucleoprotein granule 1.929 10.63

Protein sequence

External link(s) Locus: YFR037C   Protein: S000001933
Sequence length 557
Comment RSC8 SGDID:S000001933, Chr VI from 229173-227500, reverse complement, Verified ORF, "Component of the RSC chromatin remodeling complex; essential for viability and mitotic growth; homolog of SWI/SNF subunit Swi3p, but unlike Swi3p, does not activate transcription of reporters"
Sequence
MSDTEKDKDVPMVDSHEATEEPPTTSTNTPSFPHLAQEQAKEESATLGAEVAHKKINYEQ
EAQKLEEKALRFLAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKD
TRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSLIG
PSFTGHFQVVLDTPQGLKPFLPENVIKQEVEGGDGAEPQVKKEFPVNLTIKKNVYDSAQD
FNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSD
FIRLENNGNSVKKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIE
DNYIREVVGSTLNGKGGDSRDGSVSGSKLMECVNDAVQTLLQGDDKLGKVSDKSREISEK
YIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLSLSKQIL
DLNKSLEELNVSKKLVLISEQVDSGIQLVEKDQEGDDEDGNTATGHGVKRVGKEGEEVGE
GDSIAKLQPQVYKPWSL
Download sequence
Identical sequences N1P3A7 P43609
4932.YFR037C YFR037C YFR037C YFR037C YFR037C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]