SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR037C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR037C
Domain Number 1 Region: 75-181
Classification Level Classification E-value
Superfamily Homeodomain-like 8.6e-33
Family SWIRM domain 0.00013
Further Details:      
 
Domain Number 2 Region: 314-364
Classification Level Classification E-value
Superfamily Homeodomain-like 1.96e-09
Family Myb/SANT domain 0.067
Further Details:      
 
Domain Number 3 Region: 249-295
Classification Level Classification E-value
Superfamily RING/U-box 1.53e-05
Family ZZ domain 0.015
Further Details:      
 

Protein sequence

External link(s) Locus: YFR037C   Protein: S000001933
Sequence length 557
Comment RSC8 SGDID:S000001933, Chr VI from 229173-227500, reverse complement, Verified ORF, "Component of the RSC chromatin remodeling complex; essential for viability and mitotic growth; homolog of SWI/SNF subunit Swi3p, but unlike Swi3p, does not activate transcription of reporters"
Sequence
MSDTEKDKDVPMVDSHEATEEPPTTSTNTPSFPHLAQEQAKEESATLGAEVAHKKINYEQ
EAQKLEEKALRFLAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKD
TRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSLIG
PSFTGHFQVVLDTPQGLKPFLPENVIKQEVEGGDGAEPQVKKEFPVNLTIKKNVYDSAQD
FNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSD
FIRLENNGNSVKKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIE
DNYIREVVGSTLNGKGGDSRDGSVSGSKLMECVNDAVQTLLQGDDKLGKVSDKSREISEK
YIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLSLSKQIL
DLNKSLEELNVSKKLVLISEQVDSGIQLVEKDQEGDDEDGNTATGHGVKRVGKEGEEVGE
GDSIAKLQPQVYKPWSL
Download sequence
Identical sequences N1P3A7 P43609
YFR037C YFR037C 4932.YFR037C YFR037C YFR037C

Jump to [ Top of page · Domain architecture · Domain assignment details ]