SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR041C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR041C
Domain Number 1 Region: 41-139
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-19
Family Chaperone J-domain 0.0016
Further Details:      
 

Protein sequence

External link(s) Locus: YFR041C   Protein: S000001937
Sequence length 295
Comment ERJ5 SGDID:S000001937, Chr VI from 238242-237355, reverse complement, Verified ORF, "Type I membrane protein with a J domain is required to preserve the folding capacity of the endoplasmic reticulum; loss of the non-essential ERJ5 gene leads to a constitutively induced unfolded protein response"
Sequence
MNGYWKPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTK
EITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKG
GFYFSRMKPKTWFLLAFIWIVVNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVK
QLTFKQHEKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMT
FGKSVGSAGKEEIITDSKKYDGNQTKKGNKVKKGSAKKGQKKMELPNGKVIYSRK
Download sequence
Identical sequences G2WDI2 N1P4R8 P43613
YFR041C 4932.YFR041C YFR041C YFR041C YFR041C YFR041C YFR041C YFR041C

Jump to [ Top of page · Domain architecture · Domain assignment details ]