SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR041C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR041C
Domain Number 1 Region: 41-139
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-19
Family Chaperone J-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YFR041C   Protein: S000001937
Sequence length 295
Comment ERJ5 SGDID:S000001937, Chr VI from 238242-237355, reverse complement, Verified ORF, "Type I membrane protein with a J domain is required to preserve the folding capacity of the endoplasmic reticulum; loss of the non-essential ERJ5 gene leads to a constitutively induced unfolded protein response"
Sequence
MNGYWKPALVVLGLVSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTK
EITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKG
GFYFSRMKPKTWFLLAFIWIVVNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVK
QLTFKQHEKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMT
FGKSVGSAGKEEIITDSKKYDGNQTKKGNKVKKGSAKKGQKKMELPNGKVIYSRK
Download sequence
Identical sequences G2WDI2 N1P4R8 P43613
YFR041C YFR041C YFR041C YFR041C YFR041C YFR041C 4932.YFR041C YFR041C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]