SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR043C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YFR043C   Protein: S000001939
Sequence length 237
Comment IRC6 SGDID:S000001939, Chr VI from 239814-239101, reverse complement, Verified ORF, "Putative protein of unknown function; null mutant displays increased levels of spontaneous Rad52p foci"
Sequence
MVLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDS
CKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLANVN
EEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLN
CEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELSRYL
Download sequence
Identical sequences P43615
YFR043C YT434 YFR043C YFR043C YFR043C YFR043C 4932.YFR043C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]