SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YFR043C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YFR043C   Protein: S000001939
Sequence length 237
Comment IRC6 SGDID:S000001939, Chr VI from 239814-239101, reverse complement, Verified ORF, "Putative protein of unknown function; null mutant displays increased levels of spontaneous Rad52p foci"
Sequence
MVLQYPQNKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDS
CKEIPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRNTFVVLANVN
EEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLN
CEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELSRYL
Download sequence
Identical sequences P43615
YFR043C 4932.YFR043C YFR043C YFR043C YFR043C YFR043C YT434

Jump to [ Top of page · Domain architecture · Domain assignment details ]