SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL006W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL006W
Domain Number 1 Region: 59-191,324-437,889-1120
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.35e-104
Family Calcium ATPase, transmembrane domain M 0.00095
Further Details:      
 
Domain Number 2 Region: 442-461,671-946
Classification Level Classification E-value
Superfamily HAD-like 1.08e-48
Family Meta-cation ATPase, catalytic domain P 0.00022
Further Details:      
 
Domain Number 3 Region: 450-517,565-736
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.9e-26
Family Metal cation-transporting ATPase, ATP-binding domain N 0.004
Further Details:      
 
Domain Number 4 Region: 192-322
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.14e-22
Family Calcium ATPase, transduction domain A 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YGL006W   Protein: S000002974
Sequence length 1173
Comment PMC1 SGDID:S000002974, Chr VII from 485925-489446, Verified ORF, "Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a"
Sequence
MSRQDENSALLANNENNKPSYTGNENGVYDNFKLSKSQLSDLHNPKSIRSFVRLFGYESN
SLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLL
TVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKEL
QFAKLNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADES
SITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRIL
SGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLF
TRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRM
TKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRK
LNSKKVFEENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKS
RLSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQP
MEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSD
DTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDL
LFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILS
TDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTG
DGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFI
QFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDR
KPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSHQQQQLNAMT
FNTFVWLQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIGSCQV
LIMFFGGAPFSIARQTKSMWITAVLCGMLSLIMGVLVRICPDEVAVKVFPAAFVQRFKYV
FGLEFLRKNHTGKHDDEEALLEESDSPESTAFY
Download sequence
Identical sequences N1P5M0 P38929
YGL006W YGL006W YGL006W YGL006W 2362S YGL006W 4932.YGL006W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]