SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL006W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL006W
Domain Number 1 Region: 59-191,324-437,889-1120
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.35e-104
Family Calcium ATPase, transmembrane domain M 0.00095
Further Details:      
 
Domain Number 2 Region: 442-461,671-946
Classification Level Classification E-value
Superfamily HAD-like 1.08e-48
Family Meta-cation ATPase, catalytic domain P 0.00022
Further Details:      
 
Domain Number 3 Region: 450-517,565-736
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.9e-26
Family Metal cation-transporting ATPase, ATP-binding domain N 0.004
Further Details:      
 
Domain Number 4 Region: 192-322
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.14e-22
Family Calcium ATPase, transduction domain A 0.0021
Further Details:      
 

Protein sequence

External link(s) Locus: YGL006W   Protein: S000002974
Sequence length 1173
Comment PMC1 SGDID:S000002974, Chr VII from 485925-489446, Verified ORF, "Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium; similar to mammalian PMCA1a"
Sequence
MSRQDENSALLANNENNKPSYTGNENGVYDNFKLSKSQLSDLHNPKSIRSFVRLFGYESN
SLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAFNDKTMQLL
TVAAVVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKEL
QFAKLNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADES
SITGESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRIL
SGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLF
TRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRM
TKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRK
LNSKKVFEENCSSSLRNDLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKS
RLSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQP
MEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSD
DTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDL
LFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILS
TDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVTG
DGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFI
QFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATDKPDPNIMDR
KPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSHQQQQLNAMT
FNTFVWLQFFTMLVSRKLDEGDGISNWRGRISAANLNFFQDLGRNYYFLTIMAIIGSCQV
LIMFFGGAPFSIARQTKSMWITAVLCGMLSLIMGVLVRICPDEVAVKVFPAAFVQRFKYV
FGLEFLRKNHTGKHDDEEALLEESDSPESTAFY
Download sequence
Identical sequences N1P5M0 P38929
YGL006W YGL006W 4932.YGL006W YGL006W 2362S YGL006W YGL006W

Jump to [ Top of page · Domain architecture · Domain assignment details ]