SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL007W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL007W   Protein: S000002975
Sequence length 125
Comment BRP1 SGDID:S000002975, Chr VII from 483265-483642, Dubious ORF, "Dubious ORF located in the upstream region of PMA1, deletion leads to polyamine resistance due to downregulation of PMA1"
Sequence
MMEKEGKKPERHMDNILKMSIPVKSMSEVSRPGSAALGNTDAMRASLRNSRRSFSGHVRL
VLRLVYGFISAVIIAGSPLRDRVCFQITGKGQAKQSDVWVIPAMPVYVSPFQEACFVFSP
SAMVT
Download sequence
Identical sequences P53194
YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YTYst283 YGL007W YGL007W 4932.YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W YGL007W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]