SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL014C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL014C-A   Protein: S000028825
Sequence length 53
Comment YGL014C-A SGDID:S000028825, Chr VII from 466403-466242, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a functional protein; identified by expression profiling and mass spectrometry"
Sequence
MRNLHHLRVGHEAHSTHHLWMWKHLRRRAISELRILRNFIRKCIRGGVFLWII
Download sequence
Identical sequences P0C5N1
YGL014C-A YGL014C-A 4932.YGL014C-A YGL014C-A YGL014C-A YGL014C-A YGL014C-A YGL014C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]