SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGL014C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL014C-A   Protein: S000028825
Sequence length 53
Comment YGL014C-A SGDID:S000028825, Chr VII from 466403-466242, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a functional protein; identified by expression profiling and mass spectrometry"
Sequence
MRNLHHLRVGHEAHSTHHLWMWKHLRRRAISELRILRNFIRKCIRGGVFLWII
Download sequence
Identical sequences P0C5N1
YGL014C-A YGL014C-A YGL014C-A YGL014C-A YGL014C-A 4932.YGL014C-A YGL014C-A YGL014C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]