SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL017W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL017W
Domain Number 1 Region: 233-324
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.64e-09
Family N-acetyl transferase, NAT 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.419 11.15
perinuclear region of cytoplasm 1.467 5.75
nuclear chromosome 1.723 4.55
chromosomal part 1.478 4.55
chromatin 1.906 4.55

Protein sequence

External link(s) Locus: YGL017W   Protein: S000002985
Sequence length 503
Comment ATE1 SGDID:S000002985, Chr VII from 459859-461370, Verified ORF, "Arginyl-tRNA-protein transferase, catalyzes post-translational conjugation of arginine to the amino termini of acceptor proteins which are then subject to degradation via the N-end rule pathway"
Sequence
MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGS
FVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRF
ATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQD
YNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEGKL
IAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCPK
MNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRGEG
FPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLKEHNGHA
PNGIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRI
CDVIRLFGFETCMKAVILYSEQM
Download sequence
Identical sequences G2WE76 P16639
YGL017W 4932.YGL017W YGL017W YGL017W YGL017W YGL017W 355327 YR163 YR42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]