SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL017W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL017W
Domain Number 1 Region: 233-324
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.64e-09
Family N-acetyl transferase, NAT 0.057
Further Details:      
 

Protein sequence

External link(s) Locus: YGL017W   Protein: S000002985
Sequence length 503
Comment ATE1 SGDID:S000002985, Chr VII from 459859-461370, Verified ORF, "Arginyl-tRNA-protein transferase, catalyzes post-translational conjugation of arginine to the amino termini of acceptor proteins which are then subject to degradation via the N-end rule pathway"
Sequence
MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGS
FVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRF
ATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQD
YNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEGKL
IAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCPK
MNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRGEG
FPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLKEHNGHA
PNGIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRI
CDVIRLFGFETCMKAVILYSEQM
Download sequence
Identical sequences G2WE76 P16639
YGL017W 4932.YGL017W YGL017W YGL017W YGL017W YGL017W 355327 YR163 YR42

Jump to [ Top of page · Domain architecture · Domain assignment details ]