SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL026C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL026C
Domain Number 1 Region: 302-687
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 8.77e-134
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 1.44e-09
Further Details:      
 
Domain Number 2 Region: 4-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.79e-87
Family Tryptophan biosynthesis enzymes 1.43e-05
Further Details:      
 
Weak hits

Sequence:  YGL026C
Domain Number - Region: 266-310
Classification Level Classification E-value
Superfamily EF-hand 0.0793
Family Calbindin D9K 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plastid 1.598 7.45
chloroplast part 1.897 6.4
plastid stroma 2.025 6.29
cytosol 1.307 3.36

Protein sequence

External link(s) Locus: YGL026C   Protein: S000002994
Sequence length 707
Comment TRP5 SGDID:S000002994, Chr VII from 448540-446417, reverse complement, Verified ORF, "Tryptophan synthase involved in tryptophan biosynthesis, regulated by the general control system of amino acid biosynthesis"
Sequence
MSEQLRQTFANAKKENRNALVTFMTAGYPTVKDTVPILKGFQDGGVDIIELGMPFSDPIA
DGPTIQLSNTVALQNGVTLPQTLEMVSQARNEGVTVPIILMGYYNPILNYGEERFIQDAA
KAGANGFIIVDLPPEEALKVRNYINDNGLSLIPLVAPSTTDERLELLSHIADSFVYVVSR
MGTTGVQSSVASDLDELISRVRKYTKDTPLAVGFGVSTREHFQSVGSVADGVVIGSKIVT
LCGDAPEGKRYDVAKEYVQGILNGAKHKVLSKDEFFAFQKESLKSANVKKEILDEFDENH
KHPIRFGDFGGQYVPEALHACLRELEKGFDEAVADPTFWEDFKSLYSYIGRPSSLHKAER
LTEHCQGAQIWLKREDLNHTGSHKINNALAQVLLAKRLGKKNVIAETGAGQHGVATATAC
AKFGLTCTVFMGAEDVRRQALNVFRMRILGAKVIAVTNGTKTLRDATSEAFRFWVTNLKT
TYYVVGSAIGPHPYPTLVRTFQSVIGKETKEQFAAMNNGKLPDAVVACVGGGSNSTGMFS
PFEHDTSVKLLGVEAGGDGVDTKFHSATLTAGRPGVFHGVKTYVLQDSDGQVHDTHSVSA
GLDYPGVGPELAYWKSTGRAQFIAATDAQALLGFKLLSQLEGIIPALESSHAVYGACELA
KTMKPDQHLVINISGRGDKDVQSVAEVLPKLGPKIGWDLRFEEDPSA
Download sequence
Identical sequences N1P5K3 P00931
YGL026C YGL026C 4932.YGL026C YGL026C YGL026C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]