SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL030W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL030W
Domain Number 1 Region: 9-102
Classification Level Classification E-value
Superfamily L30e-like 3.7e-29
Family L30e/L7ae ribosomal proteins 8.32e-06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribonucleoprotein complex 1.418 25.13
ribosomal subunit 2.011 14.26
nucleolus 1.652 7.42
cytosol 1.307 4.53
cytosolic ribosome 2.218 3.54

Protein sequence

External link(s) Locus: YGL030W   Protein: S000002998
Sequence length 105
Comment RPL30 SGDID:S000002998, Chr VII from 439096-439098,439329-439643, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L30 ribosomal protein; involved in pre-rRNA processing in the nucleolus; autoregulates splicing of its transcript"
Sequence
MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYA
MLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Download sequence
Identical sequences A6ZUW4 C8Z8L2 G2WE64 P14120 W7PGN7 W7REE3
YGL030W 1t0kB YGL030W YGL030W YGL030W YGL030W YGL030W YGL030W YGL030W YGL030W YGL030W YGL030W YGL030W 4932.YGL030W YGL030W YGL030W YGL030W tr|A6ZUW4|A6ZUW4_YEAS7 1t0k.B 1vw8.d 1vwu.d 1vxv.d 1vxy.d 3izc.f 3izs.f 3j65.b 3o58.Z 3o5h.Z 3u5e.c 3u5i.c 4b6a.c 4cuw.c YGL030W YGL030W YGL030w___KOG2988 YGL030W YGL030W YGL030W YGL030W YGL030W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]