SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL035C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL035C
Domain Number 1 Region: 46-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000029
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Protein sequence

External link(s) Locus: YGL035C   Protein: S000003003
Sequence length 504
Comment MIG1 SGDID:S000003003, Chr VII from 433067-431553, reverse complement, Verified ORF, "Transcription factor involved in glucose repression; sequence specific DNA binding protein containing two Cys2His2 zinc finger motifs; regulated by the SNF1 kinase and the GLC7 phosphatase"
Sequence
MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMRIH
TGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRGRKKKVVGSPINSASSSATSI
PDLNTANFSPPLPQQHLSPLIPIAIAPKENSSRSSTRKGRKTKFEIGESGGNDPYMVSSP
KTMAKIPVSVKPPPSLALNNMNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIAS
SAPRTVFIDGPEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT
QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSSIDNLEQDYLQ
EQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFSSSSPDFQKELNNRLLNVQQQ
QQEQHTLLQSQNTSNQSQNQNQNQMMASSSSLSTTPLLLSPRVNMINTAISTQQTPISQS
DSQVQELETLPPIRSLPLPFPHMD
Download sequence
Identical sequences N1P1Y8 P27705
YGL035C YGL035C 4932.YGL035C YGL035C YGL035C

Jump to [ Top of page · Domain architecture · Domain assignment details ]