SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL035C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL035C
Domain Number 1 Region: 46-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-13
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.418 14.76
nucleolus 1.652 6.33
SWI/SNF superfamily-type complex 2.178 5.47
chromosomal part 1.477 5.33
ribonucleoprotein complex 1.418 5.04
small nuclear ribonucleoprotein complex 2.005 5.04
chromatin 1.902 5
nuclear body 1.902 3.87

Protein sequence

External link(s) Locus: YGL035C   Protein: S000003003
Sequence length 504
Comment MIG1 SGDID:S000003003, Chr VII from 433067-431553, reverse complement, Verified ORF, "Transcription factor involved in glucose repression; sequence specific DNA binding protein containing two Cys2His2 zinc finger motifs; regulated by the SNF1 kinase and the GLC7 phosphatase"
Sequence
MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMRIH
TGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRGRKKKVVGSPINSASSSATSI
PDLNTANFSPPLPQQHLSPLIPIAIAPKENSSRSSTRKGRKTKFEIGESGGNDPYMVSSP
KTMAKIPVSVKPPPSLALNNMNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIAS
SAPRTVFIDGPEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT
QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSSIDNLEQDYLQ
EQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFSSSSPDFQKELNNRLLNVQQQ
QQEQHTLLQSQNTSNQSQNQNQNQMMASSSSLSTTPLLLSPRVNMINTAISTQQTPISQS
DSQVQELETLPPIRSLPLPFPHMD
Download sequence
Identical sequences N1P1Y8 P27705
YGL035C YGL035C 4932.YGL035C YGL035C YGL035C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]