SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL040C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL040C
Domain Number 1 Region: 16-340
Classification Level Classification E-value
Superfamily Aldolase 2.2e-121
Family 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) 8.1e-12
Further Details:      
 

Protein sequence

External link(s) Locus: YGL040C   Protein: S000003008
Sequence length 342
Comment HEM2 SGDID:S000003008, Chr VII from 420561-419533, reverse complement, Verified ORF, "Delta-aminolevulinate dehydratase, a homo-octameric enzyme, catalyzes the conversion of delta-aminolevulinic acid to porphobilinogen, the second step in the heme biosynthetic pathway; localizes to both the cytoplasm and nucleus"
Sequence
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSL
PNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIR
EYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSD
MIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPA
GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA
EKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDEEN
Download sequence
Identical sequences A6ZUV5 B3LIQ1 C7GS20 C8Z8K3 E7KCL6 E7KNI0 E7LUF3 E7Q3W7 E7QEV2 G2WE55 H0GGA9 P05373
YGL040C 1h7nA YGL040C YGL040C YGL040C YGL040C YGL040C YGL040C YGL040C 4932.YGL040C YGL040C SCRT_01046 YGL040C YGL040C YGL040C tr|A6ZUV5|A6ZUV5_YEAS7 1h7n.A 1h7p.A 1h7r.A 1ohl.A 1qmk.A 1qml.A 1qnv.A 1w31.A YGL040C YGL040C YGL040C YGL040C YGL040C YGL040C

Jump to [ Top of page · Domain architecture · Domain assignment details ]