SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL041C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL041C   Protein: S000003009
Sequence length 104
Comment YGL041C SGDID:S000003009, Chr VII from 419231-418917, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MPDFSNSNLNSFIACLRSLSIKILIICHGFIVFSSLAEVPSRLTNFFSIMILLTFSNFSQ
NIRPRIYLIHEFLHLYVCIYFVIRLSVVPRLSVKSSRRNPGKPP
Download sequence
Identical sequences YGL041C 4932.YGL041C

Jump to [ Top of page · Domain architecture · Domain assignment details ]