SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL041C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL041C   Protein: S000003009
Sequence length 104
Comment YGL041C SGDID:S000003009, Chr VII from 419231-418917, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MPDFSNSNLNSFIACLRSLSIKILIICHGFIVFSSLAEVPSRLTNFFSIMILLTFSNFSQ
NIRPRIYLIHEFLHLYVCIYFVIRLSVVPRLSVKSSRRNPGKPP
Download sequence
Identical sequences YGL041C 4932.YGL041C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]