SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL041C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL041C-B   Protein: S000028548
Sequence length 60
Comment YGL041C-B SGDID:S000028548, Chr VII from 418891-418709, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR"
Sequence
MFDSSIERVTLELCFHITLSIMCGCSIYFLLLVFILTFYSSVLLHLKLYFFSSDRAIFNA
Download sequence
Identical sequences A6ZUV4 B3LIQ2 C7GS21 C8Z8K2 G2WE53 Q3E750
YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B 4932.YGL041C-B YGL041C-B SCRT_01047 YGL041C-B YGL041C-B tr|A6ZUV4|A6ZUV4_YEAS7 YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]