SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL041C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL041C-B   Protein: S000028548
Sequence length 60
Comment YGL041C-B SGDID:S000028548, Chr VII from 418891-418709, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR"
Sequence
MFDSSIERVTLELCFHITLSIMCGCSIYFLLLVFILTFYSSVLLHLKLYFFSSDRAIFNA
Download sequence
Identical sequences A6ZUV4 B3LIQ2 C7GS21 C8Z8K2 G2WE53 Q3E750 W7Q357 W7RED5
YGL041C-B YGL041C-B 4932.YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B SCRT_01047 YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B tr|A6ZUV4|A6ZUV4_YEAS7 YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B YGL041C-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]