SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGL042C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL042C   Protein: S000003010
Sequence length 101
Comment YGL042C SGDID:S000003010, Chr VII from 418597-418292, reverse complement, Dubious ORF, "Dubious open reading frame, not conserved in closely related Saccharomyces species; deletion mutation blocks replication of Brome mosaic virus in S. cerevisiae, but this is likely due to effects on the overlapping gene DST1"
Sequence
MYIVYEYAISTNWIWLYVWLFLFLDSGCQILLRIESEQAFLSLPPIVSFALSVATLIFFY
SKRISICYHMLHMYRKWSMVHPQILFAIDSKIPSSLYIYHM
Download sequence
Identical sequences P53181
YGL042C YGL042C 4932.YGL042C YGL042C YGL042C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]