SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL045W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL045W
Domain Number 1 Region: 38-206
Classification Level Classification E-value
Superfamily E set domains 0.0000000014
Family Arrestin/Vps26-like 0.027
Further Details:      
 
Weak hits

Sequence:  YGL045W
Domain Number - Region: 249-310
Classification Level Classification E-value
Superfamily E set domains 0.0084
Family Arrestin/Vps26-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
receptor complex 1.511 25.85
extracellular space 1.521 23.93
integral component of plasma membrane 1.462 16.92
transferase complex 1.423 15.55
cation channel complex 2.046 9.35
cell cortex 1.627 8.48
transcription factor complex 1.912 8.24
cilium 1.573 6.04
nonmotile primary cilium 1.962 6.04
actin filament 2.159 5.27

Protein sequence

External link(s) Locus: YGL045W   Protein: S000003013
Sequence length 542
Comment RIM8 SGDID:S000003013, Chr VII from 414106-415734, Verified ORF, "Protein of unknown function, involved in the proteolytic activation of Rim101p in response to alkaline pH; has similarity to A. nidulans PalF"
Sequence
MSLLRLWNKESRAPSKIKSHGIVGSYGNSMLAHNNVKQFRIDIDEPHRVWKPNESITGEA
VIDIKRDITNVAIKLSLVCEVRVKTGNSPTSKNKRIEKTLEKSTFLYGQDYVKTAFSAKE
KKPHVDKTTILNGLSKGEHRFPFRIRIPRGRGMLSSIKFERGSITYFLSCTLESLNNING
LKKPEARCEREFAVIVPLDVSRLPKPKTKTVVLQSASMVQNKKNKSTEDESSSYTQLTQK
STTSNSSSSSVNSKTSPLPNKTVTISVDIPQAGFMIGEIIPIDVKIDHYKPFYAPAGLTT
TLVRICRVGGAGKDDPMETFRKDICQSISPIYINPETLQFQSRVYLKVPLDAFSTLTTVG
KFFSFQYYIEVMVNLSKKNVVYTESNRIIGTPIGEQNGLGVENNINRIQRKMLRMVNPET
LENDSEGYESSIFFKDMVNVEKLKRLRNVTGMSIETVIGTTRSEQQQSDASIPSQSSITA
PQNSPSNLRDWLAPLNAYDSDDVPVPKYSPNDKVSVPSEDKQELEQKRLQQLESDPPPCD
DY
Download sequence
Identical sequences E7NHP7 N1P391 P53179
YGL045W YGL045W YGL045W YGL045W YGL045W 4932.YGL045W YGL045W YGL045W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]