SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL045W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL045W
Domain Number 1 Region: 38-206
Classification Level Classification E-value
Superfamily E set domains 1.4e-09
Family Arrestin/Vps26-like 0.027
Further Details:      
 
Weak hits

Sequence:  YGL045W
Domain Number - Region: 249-310
Classification Level Classification E-value
Superfamily E set domains 0.0084
Family Arrestin/Vps26-like 0.038
Further Details:      
 

Protein sequence

External link(s) Locus: YGL045W   Protein: S000003013
Sequence length 542
Comment RIM8 SGDID:S000003013, Chr VII from 414106-415734, Verified ORF, "Protein of unknown function, involved in the proteolytic activation of Rim101p in response to alkaline pH; has similarity to A. nidulans PalF"
Sequence
MSLLRLWNKESRAPSKIKSHGIVGSYGNSMLAHNNVKQFRIDIDEPHRVWKPNESITGEA
VIDIKRDITNVAIKLSLVCEVRVKTGNSPTSKNKRIEKTLEKSTFLYGQDYVKTAFSAKE
KKPHVDKTTILNGLSKGEHRFPFRIRIPRGRGMLSSIKFERGSITYFLSCTLESLNNING
LKKPEARCEREFAVIVPLDVSRLPKPKTKTVVLQSASMVQNKKNKSTEDESSSYTQLTQK
STTSNSSSSSVNSKTSPLPNKTVTISVDIPQAGFMIGEIIPIDVKIDHYKPFYAPAGLTT
TLVRICRVGGAGKDDPMETFRKDICQSISPIYINPETLQFQSRVYLKVPLDAFSTLTTVG
KFFSFQYYIEVMVNLSKKNVVYTESNRIIGTPIGEQNGLGVENNINRIQRKMLRMVNPET
LENDSEGYESSIFFKDMVNVEKLKRLRNVTGMSIETVIGTTRSEQQQSDASIPSQSSITA
PQNSPSNLRDWLAPLNAYDSDDVPVPKYSPNDKVSVPSEDKQELEQKRLQQLESDPPPCD
DY
Download sequence
Identical sequences E7NHP7 P53179
YGL045W YGL045W 4932.YGL045W YGL045W YGL045W YGL045W YGL045W YGL045W

Jump to [ Top of page · Domain architecture · Domain assignment details ]