SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL058W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL058W
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily UBC-like 3.19e-59
Family UBC-related 9.91e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
endosome 1.322 33.5
ubiquitin ligase complex 1.933 17.28
endosome membrane 1.967 7.79
chromosomal part 1.478 5.67
chromatin 1.906 5.67
ribonucleoprotein complex 1.415 4.32
spliceosomal complex 2.017 4.32

Protein sequence

External link(s) Locus: YGL058W   Protein: S000003026
Sequence length 172
Comment RAD6 SGDID:S000003026, Chr VII from 393992-394510, Verified ORF, "Ubiquitin-conjugating enzyme (E2), involved in postreplication repair (with Rad18p), sporulation, telomere silencing, and ubiquitin-mediated N-end rule protein degradation (with Ubr1p)"
Sequence
MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFD
EEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS
PANVEAATLFKDHKSQYVKRVKETVEKSWEDDMDDMDDDDDDDDDDDDDEAD
Download sequence
Identical sequences E7KCI3 E7KNG9 E7QEU1 N1P383 P06104
YGL058W YGL058W 4932.YGL058W YGL058W YGL058W YGL058W YGL058W YGL058W YGL058W YGL058w___KOG0419 YGL058W YGL058W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]