SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL058W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL058W
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily UBC-like 3.19e-59
Family UBC-related 9.91e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YGL058W   Protein: S000003026
Sequence length 172
Comment RAD6 SGDID:S000003026, Chr VII from 393992-394510, Verified ORF, "Ubiquitin-conjugating enzyme (E2), involved in postreplication repair (with Rad18p), sporulation, telomere silencing, and ubiquitin-mediated N-end rule protein degradation (with Ubr1p)"
Sequence
MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFD
EEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS
PANVEAATLFKDHKSQYVKRVKETVEKSWEDDMDDMDDDDDDDDDDDDDEAD
Download sequence
Identical sequences E7KCI3 E7KNG9 E7QEU1 P06104
YGL058W YGL058W 4932.YGL058W YGL058W YGL058W YGL058W YGL058W YGL058W YGL058W YGL058W YGL058W

Jump to [ Top of page · Domain architecture · Domain assignment details ]