SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL062W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL062W
Domain Number 1 Region: 553-859
Classification Level Classification E-value
Superfamily Aldolase 2.38e-79
Family HMGL-like 2.86e-06
Further Details:      
 
Domain Number 2 Region: 103-373
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.65e-70
Family BC ATP-binding domain-like 3.11e-06
Further Details:      
 
Domain Number 3 Region: 856-1031
Classification Level Classification E-value
Superfamily post-HMGL domain-like 1.02e-49
Family Conserved carboxylase domain 0.0035
Further Details:      
 
Domain Number 4 Region: 13-131
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.44e-40
Family BC N-terminal domain-like 6.76e-05
Further Details:      
 
Domain Number 5 Region: 354-472
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.34e-37
Family BC C-terminal domain-like 0.00012
Further Details:      
 
Domain Number 6 Region: 1091-1169
Classification Level Classification E-value
Superfamily Single hybrid motif 2.49e-19
Family Biotinyl/lipoyl-carrier proteins and domains 0.00088
Further Details:      
 

Protein sequence

External link(s) Locus: YGL062W   Protein: S000003030
Sequence length 1178
Comment PYC1 SGDID:S000003030, Chr VII from 385199-388735, Verified ORF, "Pyruvate carboxylase isoform, cytoplasmic enzyme that converts pyruvate to oxaloacetate; highly similar to isoform Pyc2p but differentially regulated; mutations in the human homolog are associated with lactic acidosis"
Sequence
MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ
KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI
TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA
FGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN
VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN
QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQC
RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY
EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR
AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL
EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC
WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIA
EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA
LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF
EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT
SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN
KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL
SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV
ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII
SSPSDGQVKEVFVSDGENVDSSDLLVLLEDQVPVETKA
Download sequence
Identical sequences P11154
YGL062W 4932.YGL062W YGL062W YR258 YGL062W

Jump to [ Top of page · Domain architecture · Domain assignment details ]