SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL062W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL062W
Domain Number 1 Region: 553-859
Classification Level Classification E-value
Superfamily Aldolase 2.38e-79
Family HMGL-like 0.00000286
Further Details:      
 
Domain Number 2 Region: 103-373
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.65e-70
Family BC ATP-binding domain-like 0.00000311
Further Details:      
 
Domain Number 3 Region: 856-1031
Classification Level Classification E-value
Superfamily post-HMGL domain-like 1.02e-49
Family Conserved carboxylase domain 0.0035
Further Details:      
 
Domain Number 4 Region: 13-131
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.44e-40
Family BC N-terminal domain-like 0.0000676
Further Details:      
 
Domain Number 5 Region: 354-472
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.34e-37
Family BC C-terminal domain-like 0.00012
Further Details:      
 
Domain Number 6 Region: 1091-1169
Classification Level Classification E-value
Superfamily Single hybrid motif 2.49e-19
Family Biotinyl/lipoyl-carrier proteins and domains 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
oxidoreductase complex 1.872 28.65
transferase complex 1.423 22.56
cytoplasmic vesicle part 1.73 14.5
cilium 1.573 8.39
axon 1.505 7.32
ciliary part 1.844 6.94
microtubule cytoskeleton 1.341 6.88
microtubule associated complex 1.998 6.88
chloroplast part 1.896 6.8
lipid particle 1.469 5.64

Protein sequence

External link(s) Locus: YGL062W   Protein: S000003030
Sequence length 1178
Comment PYC1 SGDID:S000003030, Chr VII from 385199-388735, Verified ORF, "Pyruvate carboxylase isoform, cytoplasmic enzyme that converts pyruvate to oxaloacetate; highly similar to isoform Pyc2p but differentially regulated; mutations in the human homolog are associated with lactic acidosis"
Sequence
MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ
KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI
TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA
FGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN
VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN
QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQC
RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY
EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR
AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL
EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC
WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIA
EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA
LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF
EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT
SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN
KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL
SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV
ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII
SSPSDGQVKEVFVSDGENVDSSDLLVLLEDQVPVETKA
Download sequence
Identical sequences P11154
YR258 4932.YGL062W YGL062W YGL062W YGL062W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]