SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL063C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL063C-A   Protein: S000028633
Sequence length 49
Comment YGL063C-A SGDID:S000028633, Chr VII from 384654-384505, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a functional protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MRSRVISSGRISQYSKLRNLVLYPSNTGPSNNRPCAGALGMYFLGPALK
Download sequence
Identical sequences C8Z8I4 Q8TGP0
YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A 4932.YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]