SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGL063C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL063C-A   Protein: S000028633
Sequence length 49
Comment YGL063C-A SGDID:S000028633, Chr VII from 384654-384505, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a functional protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MRSRVISSGRISQYSKLRNLVLYPSNTGPSNNRPCAGALGMYFLGPALK
Download sequence
Identical sequences C8Z8I4 Q8TGP0
YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A 4932.YGL063C-A YGL063C-A YGL063C-A YGL063C-A YGL063C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]