SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL065C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL065C
Domain Number 1 Region: 9-434
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.02e-51
Family Glycosyl transferases group 1 0.0014
Further Details:      
 

Protein sequence

External link(s) Locus: YGL065C   Protein: S000003033
Sequence length 503
Comment ALG2 SGDID:S000003033, Chr VII from 381274-379763, reverse complement, Verified ORF, "Mannosyltransferase that catalyzes two consecutive steps in the N-linked glycosylation pathway; alg2 mutants exhibit temperature-sensitive growth and abnormal accumulation of the lipid-linked oligosaccharide Man2GlcNAc2-PP-Dol"
Sequence
MIEKDKRTIAFIHPDLGIGGAERLVVDAALGLQQQGHSVIIYTSHCDKSHCFEEVKNGQL
KVEVYGDFLPTNFLGRFFIVFATIRQLYLVIQLILQKKVNAYQLIIIDQLSTCIPLLHIF
SSATLMFYCHFPDQLLAQRAGLLKKIYRLPFDLIEQFSVSAADTVVVNSNFTKNTFHQTF
KYLSNDPDVIYPCVDLSTIEIEDIDKKFFKTVFNEGDRFYLSINRFEKKKDVALAIKAFA
LSEDQINDNVKLVICGGYDERVAENVEYLKELQSLADEYELSHTTIYYQEIKRVSDLESF
KTNNSKIIFLTSISSSLKELLLERTEMLLYTPAYEHFGIVPLEAMKLGKPVLAVNNGGPL
ETIKSYVAGENESSATGWLKPAVPIQWATAIDESRKILQNGSVNFERNGPLRVKKYFSRE
AMTQSFEENVEKVIWKEKKYYPWEIFGISFSNFILHMAFIKILPNNPWPFLFMATFMVLY
FKNYLWGIYWAFVFALSYPYEEI
Download sequence
Identical sequences C7GW45 N1P9R0 P43636
YGL065C 4932.YGL065C YGL065C YGL065C YGL065C YGL065c___KOG0853 2393S YGL065C YGL065C

Jump to [ Top of page · Domain architecture · Domain assignment details ]