SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL065C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL065C
Domain Number 1 Region: 9-434
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.02e-51
Family Glycosyl transferases group 1 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transferase activity, transferring hexosyl groups 2.238 154.46
phosphoric ester hydrolase activity 1.603 43.44
isomerase activity 1.671 37.67
monocarboxylic acid binding 1.996 13.14
carbohydrate binding 1.685 7.45
carboxylic acid binding 1.483 6.93
drug binding 2.138 3.98
Cellular Component IC (bits) H-Score
external encapsulating structure 1.636 8.1
cell wall 1.752 8.1
plastid 1.598 7.59
nuclear outer membrane-endoplasmic reticulum membrane network 1.56 6.08
chloroplast part 1.897 6.08
outer membrane 2.24 5.63
endoplasmic reticulum part 1.433 5.52

Protein sequence

External link(s) Locus: YGL065C   Protein: S000003033
Sequence length 503
Comment ALG2 SGDID:S000003033, Chr VII from 381274-379763, reverse complement, Verified ORF, "Mannosyltransferase that catalyzes two consecutive steps in the N-linked glycosylation pathway; alg2 mutants exhibit temperature-sensitive growth and abnormal accumulation of the lipid-linked oligosaccharide Man2GlcNAc2-PP-Dol"
Sequence
MIEKDKRTIAFIHPDLGIGGAERLVVDAALGLQQQGHSVIIYTSHCDKSHCFEEVKNGQL
KVEVYGDFLPTNFLGRFFIVFATIRQLYLVIQLILQKKVNAYQLIIIDQLSTCIPLLHIF
SSATLMFYCHFPDQLLAQRAGLLKKIYRLPFDLIEQFSVSAADTVVVNSNFTKNTFHQTF
KYLSNDPDVIYPCVDLSTIEIEDIDKKFFKTVFNEGDRFYLSINRFEKKKDVALAIKAFA
LSEDQINDNVKLVICGGYDERVAENVEYLKELQSLADEYELSHTTIYYQEIKRVSDLESF
KTNNSKIIFLTSISSSLKELLLERTEMLLYTPAYEHFGIVPLEAMKLGKPVLAVNNGGPL
ETIKSYVAGENESSATGWLKPAVPIQWATAIDESRKILQNGSVNFERNGPLRVKKYFSRE
AMTQSFEENVEKVIWKEKKYYPWEIFGISFSNFILHMAFIKILPNNPWPFLFMATFMVLY
FKNYLWGIYWAFVFALSYPYEEI
Download sequence
Identical sequences C7GW45 N1P9R0 P43636
YGL065C 4932.YGL065C YGL065C YGL065C YGL065C YGL065c___KOG0853 2393S YGL065C YGL065C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]