SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL100W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL100W
Domain Number 1 Region: 7-247,294-333
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.02e-43
Family WD40-repeat 0.0027
Further Details:      
 

Protein sequence

External link(s) Locus: YGL100W   Protein: S000003068
Sequence length 349
Comment SEH1 SGDID:S000003068, Chr VII from 313237-314286, Verified ORF, "Nuclear pore protein that is part of the evolutionarily conserved Nup84p complex (Nup84p, Nup85p, Nup120p, Nup145p, and Seh1p); homologous to Sec13p"
Sequence
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVA
IDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAH
LGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSP
EKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRI
RIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEH
DDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ
Download sequence
Identical sequences C8Z8E8 H0GG62 N1P3I3 P53011
3ewe.A 3ewe.C YGL100W 4932.YGL100W YGL100W YGL100W YGL100W YGL100W

Jump to [ Top of page · Domain architecture · Domain assignment details ]