SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL113W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL113W   Protein: S000003081
Sequence length 668
Comment SLD3 SGDID:S000003081, Chr VII from 295935-297941, Verified ORF, "Protein involved in the initiation of DNA replication, required for proper assembly of replication proteins at the origins of replication; interacts with Cdc45p"
Sequence
METWEVIASVKEATKGLDLSLDHPLIIKSEDVPSNILQLLQQKNRRQLKHICMKSRKEYF
LLEEYGPGFWVKWPYNYFNGYSLPERRTEVVTTVERERAKRETLKTWDELKFKELLHLWS
EEPKGSCKLEKDKDLKLDMNPPDMKGESKINDYYSDPKEYIESKYYDALFSIHTPLAYFV
KSNLVRLKNTCRTKYGSDSYKIAYQAMLQKFLLSIVQFKDRHDNRLLLEPFSSPIADEKR
KNCLTKFVIQDENKNSSTIADLCVVLKSREIKLQILLLLEIIGLNDLDWNFRDFEKKYKL
KLKKRSLNLTKKGLVRRRSKKKTSEKDKGIERITTSLDYCEQLDLYLDRACILDILLSSE
TPNPDAIEASNGTIQEHKKNILDKSKEASLVGFINYVLIPYFNKKVPHAVEFIIQKLKGP
SMRPKRALKKVNDSTNVSSPNTVETYNRLSTSQRASRSSIINSVPSSPALRRVDANLFSR
KSIASPTPELLNSRTNSNLNEFLESETRSLKRPSQLGRTKSDLTMNHLQKRQFSVSDLST
TRVPNSSTITLKTPFSHSTINAYKTMNNSFRRVGKRKDINETIRLHERVDSEENVQVQAT
PAVKKRTVTPNKKAQLQSIIESPLNFKDDDTHEGRKNTSNITSTPTNKPPENSSKRRVRR
RLFAPEST
Download sequence
Identical sequences B3LHH6 N1P1T1 P53135 W7PL81 W7R301
YGL113W SCRT_01109 YGL113W YGL113W YGL113W YGL113W 4932.YGL113W YGL113W YGL113W YGL113W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]