SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL113W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL113W   Protein: S000003081
Sequence length 668
Comment SLD3 SGDID:S000003081, Chr VII from 295935-297941, Verified ORF, "Protein involved in the initiation of DNA replication, required for proper assembly of replication proteins at the origins of replication; interacts with Cdc45p"
Sequence
METWEVIASVKEATKGLDLSLDHPLIIKSEDVPSNILQLLQQKNRRQLKHICMKSRKEYF
LLEEYGPGFWVKWPYNYFNGYSLPERRTEVVTTVERERAKRETLKTWDELKFKELLHLWS
EEPKGSCKLEKDKDLKLDMNPPDMKGESKINDYYSDPKEYIESKYYDALFSIHTPLAYFV
KSNLVRLKNTCRTKYGSDSYKIAYQAMLQKFLLSIVQFKDRHDNRLLLEPFSSPIADEKR
KNCLTKFVIQDENKNSSTIADLCVVLKSREIKLQILLLLEIIGLNDLDWNFRDFEKKYKL
KLKKRSLNLTKKGLVRRRSKKKTSEKDKGIERITTSLDYCEQLDLYLDRACILDILLSSE
TPNPDAIEASNGTIQEHKKNILDKSKEASLVGFINYVLIPYFNKKVPHAVEFIIQKLKGP
SMRPKRALKKVNDSTNVSSPNTVETYNRLSTSQRASRSSIINSVPSSPALRRVDANLFSR
KSIASPTPELLNSRTNSNLNEFLESETRSLKRPSQLGRTKSDLTMNHLQKRQFSVSDLST
TRVPNSSTITLKTPFSHSTINAYKTMNNSFRRVGKRKDINETIRLHERVDSEENVQVQAT
PAVKKRTVTPNKKAQLQSIIESPLNFKDDDTHEGRKNTSNITSTPTNKPPENSSKRRVRR
RLFAPEST
Download sequence
Identical sequences B3LHH6 P53135
YGL113W YGL113W 4932.YGL113W YGL113W YGL113W SCRT_01109 YGL113W YGL113W YGL113W YGL113W

Jump to [ Top of page · Domain architecture · Domain assignment details ]