SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL123C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL123C-A   Protein: S000028634
Sequence length 76
Comment YGL123C-A SGDID:S000028634, Chr VII from 277870-277640, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene RPS2/YGL123W"
Sequence
MFMTSSCKPGNKVSMIWNSLTGKECKKISSMVVILPALTNLPSLVTGTHPFSSVFLGPLL
FGRPLLRPPKPPLFCC
Download sequence
Identical sequences C8Z8C8 Q8TGP1
YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A 4932.YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]