SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL123C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL123C-A   Protein: S000028634
Sequence length 76
Comment YGL123C-A SGDID:S000028634, Chr VII from 277870-277640, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene RPS2/YGL123W"
Sequence
MFMTSSCKPGNKVSMIWNSLTGKECKKISSMVVILPALTNLPSLVTGTHPFSSVFLGPLL
FGRPLLRPPKPPLFCC
Download sequence
Identical sequences C8Z8C8 Q8TGP1
YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A 4932.YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A YGL123C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]